KEGG   Candidatus Moranella endobia PCIT: MEPCIT_279Help
Entry
MEPCIT_279        CDS       T01562                                 

Gene name
tim
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
men  Candidatus Moranella endobia PCIT
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:men00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MEPCIT_279 (tim)
   01230 Biosynthesis of amino acids
    MEPCIT_279 (tim)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MEPCIT_279 (tim)
   00051 Fructose and mannose metabolism
    MEPCIT_279 (tim)
   00562 Inositol phosphate metabolism
    MEPCIT_279 (tim)
Enzymes [BR:men01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MEPCIT_279 (tim)
Exosome [BR:men04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MEPCIT_279 (tim)
  Exosomal proteins of bladder cancer cells
   MEPCIT_279 (tim)
  Exosomal proteins of melanoma cells
   MEPCIT_279 (tim)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
333407..334201
Genome map
AA seq 264 aa AA seqDB search
MRHPLVIGNWKLNGSTEMVKELIVALCNKLSNVIGCDVVIAPPVVYLDLAKHHLGISNSN
LTLGAQNVDTNIAGAFTGEVSASMLKDIGAKYIIIGHSERRTYHKESDDNIVKKFTVLKL
TGLIPILCIGESEAENQDGKTESVCARQLDAVINHLGVQALENCVIAYEPIWAIGTGKSA
KPTQVQAVHKFIRGYIAKHNVEIAENIIILYGGSVNPSNATELFTQLDIDGALVGGASLM
ADTFVLIVKAAAQAKQNLRSAALT
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatccgttagtaataggtaattggaaacttaacggcagcacagaaatggtaaaa
gaactgattgtggcgctgtgtaataaactcagtaacgttattggctgtgatgtggttatc
gccccgccagtagtctatcttgatctggcaaaacatcatttgggtatcagcaatagcaat
cttactctcggagcgcagaatgtcgataccaatattgctggcgcttttacaggtgaagtt
tccgcttcgatgctcaaagatatcggcgctaaatacattatcattggtcattcagaacgc
cgcacctatcataaagaaagtgatgataatattgtcaaaaaattcactgtgttaaaatta
actggtctaattccgatattgtgtatcggtgaaagcgaagcagaaaaccaagacggaaaa
actgagtcggtatgcgctcgtcagcttgatgcagtcattaaccatttaggcgtccaagcg
ttagaaaattgcgtcatagcctatgagcctatctgggccattggcactggtaaatccgca
aaaccgacgcaggttcaggcggtacacaaatttatccgcgggtatattgctaaacataat
gttgaaattgcagaaaatattattatcctgtatggtggttcggttaatcccagcaatgcc
actgaactatttactcagcttgatattgatggtgctctggtcggcggtgcatcgctgatg
gctgacacattcgtattgattgttaaagctgcagcgcaagcaaaacaaaacttacggtcg
gctgccttaacttaa

DBGET integrated database retrieval system