KEGG   Candidatus Moranella endobia PCIT: MEPCIT_280Help
Entry
MEPCIT_280        CDS       T01562                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
men  Candidatus Moranella endobia PCIT
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:men00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MEPCIT_280 (pfkA)
   01230 Biosynthesis of amino acids
    MEPCIT_280 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MEPCIT_280 (pfkA)
   00030 Pentose phosphate pathway
    MEPCIT_280 (pfkA)
   00051 Fructose and mannose metabolism
    MEPCIT_280 (pfkA)
   00052 Galactose metabolism
    MEPCIT_280 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    MEPCIT_280 (pfkA)
Enzymes [BR:men01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MEPCIT_280 (pfkA)
Protein phosphatases and associated proteins [BR:men01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MEPCIT_280 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(334318..335280)
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDSPGMNAAIRGVVRAGLAENLEVYGIYDGYLGLFQDCMSKLDRYSVSD
IINRGGTFLGSVRFPEFQDEHTRAIAINNMTKRGLDALVVIGGDGSYLGAKRLTEMGFPC
IGLPGTIDNDVAGTDYTIGYFTALETVVEAIDRLRDTSTSHQRISIVEVMGRYCGDLTMA
SAIAGGCEFIVLPEVEFKPADLVSEIKAGIAKGKKHAIVAITEHICNLAEIAQYIEKETG
RETRTTVLGHIQRGGRPVAYDRVLASRMGAYSIELLLQGYGGHCIGVQNERLVHHDIVDA
IENMKRPFRKDILETAKKLF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaaatcggtgtactaacaagtggtggtgattcaccaggtatgaatgctgcc
ataaggggcgtagtacgggcagggctggccgaaaatttggaagtgtatggcatttatgac
ggctacctgggattatttcaagattgtatgtcgaaacttgatcgctatagcgtttctgat
ataattaaccgtggtggtacctttctcggttccgtacgttttcccgaattccaagatgaa
catactcgagctatcgccattaataacatgaccaaacgcggcctagatgcgctggtagta
ataggaggcgatggctcatatttgggtgccaaacgcctaacagagatgggttttccctgc
attggtctacctggtacaattgataatgatgttgctggtaccgattatactattggctat
tttactgcactcgaaactgtcgtcgaggctattgatcgactgcgagatacctcgacgtca
catcaacgcatctccattgttgaagttatggggcggtattgcggtgatcttactatggcg
tcagccatcgccggaggttgcgaattcatagtgttacctgaagttgaattcaaacctgcc
gacctagtttctgaaataaaggcaggtatcgctaaaggcaaaaaacacgcaattgtcgcg
atcaccgaacatatctgtaatctcgctgagatagctcaatatattgaaaaagaaacagga
agggaaactcgcactacagtgttgggtcatatccaacgaggcggccgcccggtggcgtat
gatcgtgtgttagcatcccgtatgggcgcgtactccattgagctgctattacaaggttat
ggtggccactgtattggggtgcaaaatgagagactcgtgcatcatgatatagtagacgca
atcgaaaatatgaagcgacccttccgcaaggatatcctggaaactgcgaaaaaactattc
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system