KEGG   Methylovorus sp. MP688: MPQ_0033Help
Entry
MPQ_0033          CDS       T01361                                 

Gene name
hemD
Definition
uroporphyrinogen iii synthase hem4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mep  Methylovorus sp. MP688
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mep00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MPQ_0033 (hemD)
Enzymes [BR:mep01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     MPQ_0033 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(37153..37932)
Genome map
AA seq 259 aa AA seqDB search
MALTGLSVAITRPLDQATRLSRLIVEAGGTPYGFPLIEIAPLADYSAFDAQLHELGKYDW
TIFISSNAVQNAIPRMLNLVGQPPATLRHAAIGPVTAAELTRLGIGPVLTPQGRYDSESL
LALPEMQQVKGQRFLIFRGVGGRELLAESLRARGATVDFAECYRRINPQTSAEPLEQRWQ
QQQLDAVVVTSSEAMRYLLNMTNNGQHAWIRDVTLCVNHARIAELPIELGLRVIVAEAPG
DDAMLQCLNTVALLKQQRH
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
gtggcattgacaggcttgtcggtggcgatcacccggccgttggatcaggccacgcgcttg
tcgcgcttgatcgtggaagcaggcggaacgccctatggctttccgctgattgaaattgcc
ccgttggcagattacagcgcatttgatgcccagctgcatgagctcggcaagtacgattgg
actatttttatcagcagtaatgcggttcagaatgccataccaaggatgctgaatctggtc
ggccagccgccagccacattgcggcatgctgccattggcccggtcaccgctgccgaactg
accaggctgggcatcgggccagtgctaacgccacaaggcaggtatgatagtgaatcgcta
ctggcactccccgagatgcagcaggtaaaggggcaacggtttttgattttccgtggagtg
ggtggccgggaactgctggcagagagcctgcgagcccgcggagctactgtggattttgcc
gaatgctaccgccgcatcaacccgcaaaccagcgcagagccactggaacagcgttggcaa
caacagcagcttgatgccgttgtagtcaccagcagtgaagccatgcgctatttgctgaac
atgacgaataacggacagcacgcctggatacgcgatgtgacactgtgtgtgaatcatgca
cgcattgccgaactgcccattgagcttggattgcgcgtcatcgtggcagaagcgccggga
gacgatgccatgctgcaatgcctgaatactgtagccctcttgaaacaacaacgacactga

DBGET integrated database retrieval system