KEGG   Methylovorus sp. MP688: MPQ_0042Help
Entry
MPQ_0042          CDS       T01361                                 

Gene name
celA
Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mep  Methylovorus sp. MP688
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mep00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MPQ_0042 (celA)
Enzymes [BR:mep01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     MPQ_0042 (celA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
48599..49621
Genome map
AA seq 340 aa AA seqDB search
MRDKSLSYFKALLLGLLVQFGSASAMAGQADWTEFKQRFVLAEGRVVDVGNGGISHSEGQ
GVTMLLAVHYNDQKTFDRLWQWTQSALQVRKDRLLAWRWTTKQGVSDFNNATDGDLYVAW
ALLRAADKWHVPAYKKAAEAILNDVKRLLVKPSKWGPVILPGSAGFEKPAGQIVNLSYWI
FPALNDFSRYAPDPVWDQLGESGVAIIRESHFGKWQLPTDWVQLGSKVTPAPGFPAQFGY
DAVRVPFFLMWGKKANANLLAPFQAFWGYYQKTPYLPPTVSMENDAVAPYGAAPGILNIA
DLTCRYPAVAPRPDYPINTQDYYSATLLLLADMMVGEQAR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagggataagtctttatcttactttaaggcactgctgctgggtttgctagttcaattt
ggcagcgcttctgccatggcaggccaggccgattggacggaattcaagcagcgctttgtg
ctggccgaggggcgggtggtggatgtgggcaatggcggcatcagccattccgaaggccag
ggcgtcaccatgctgctggccgtgcattacaacgatcaaaaaacctttgatcgcctgtgg
cagtggacgcaaagcgcactgcaggtgcgcaaggatcgcctgcttgcctggcgctggacc
accaaacaaggggtgagcgacttcaacaatgccacggatggcgacttgtatgtggcgtgg
gcgctgctgcgcgccgcagataaatggcatgtgcccgcgtataaaaaggcagcagaggca
attctcaacgatgtgaagcggctactggtaaagccgagcaaatggggccccgtgattctg
cccggctcggcaggttttgaaaaaccggctggccagatcgttaatctgtcttactggatt
ttcccggccttgaatgatttcagtcggtatgcgccggatccggtgtgggatcaactgggc
gagagcggcgtcgccatcatccgtgaaagtcatttcggcaaatggcagttgcccactgac
tgggtgcagctcggtagcaaggtgacgccagcgccggggttccctgcgcaatttgggtat
gacgcggtgcgcgtgccgttcttcctcatgtggggcaaaaaagccaacgccaacctgctg
gcacctttccaggcgttctggggctattaccagaaaactccgtatctgccgcctaccgtc
agcatggaaaacgatgcagtcgccccgtatggtgcggcgcccggcatactcaatattgcc
gacctcacatgccgctatccagcggtagcgccccggcctgactatccgatcaacacgcag
gattattactcggccacgctgttgctgctggccgatatgatggtcggggagcaggcacgt
tga

DBGET integrated database retrieval system