KEGG   Methylovorus sp. MP688: MPQ_0051Help
Entry
MPQ_0051          CDS       T01361                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
mep  Methylovorus sp. MP688
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mep00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MPQ_0051 (gmk)
Enzymes [BR:mep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     MPQ_0051 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
58147..58755
Genome map
AA seq 202 aa AA seqDB search
MTGNLFIITAASGAGKTSLVRELLASDSQIQLSVSYTTRKPRPGEMDGVHYHFVEEAEFM
RMLEASDFLESAHVHGARYGTSQSRVESVLKQGNDLILEIDWQGAAQVRSLYPQAISIFI
LPPSLEALEQRLHGRGQDSAEVIARRLAAARDEMRHVVEFDYVTINDDFEVALNDLRAII
RTQRLQREKQLLRHQDLLEKLI
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgacaggcaatctatttatcatcaccgcagcttctggcgcgggcaaaaccagtctggtg
cgcgaattgctggcgtcagacagccagatccagctatcggtgtcgtacaccacccgcaag
ccgcgaccaggcgagatggacggggtgcattatcactttgtggaagaggctgaattcatg
cgcatgctggaagccagcgactttctggaaagtgcgcatgtgcatggtgcgcgctatggg
acatcgcaaagccgggtggaaagcgtgttgaagcaaggcaatgacctgattctggagatt
gactggcagggcgctgcccaggtgcgcagtctttacccgcaggccatcagcatttttatt
ttgccaccctcgctggaggcactggagcagcgcctgcacggccgtggacaggatagcgcc
gaagtgattgcccgtcgactggcggctgctcgcgatgagatgcgccatgtggtcgagttc
gactatgttacaattaacgacgattttgaggtggcgctaaatgatctgcgcgccatcatc
cgcacccagcgtttgcagcgcgaaaagcagttgctgcggcaccaggatctgctggaaaaa
ctcatatag

DBGET integrated database retrieval system