KEGG   Methylovorus sp. MP688: MPQ_0279Help
Entry
MPQ_0279          CDS       T01361                                 

Gene name
hisD
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
mep  Methylovorus sp. MP688
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mep00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MPQ_0279 (hisD)
  Amino acid metabolism
   00340 Histidine metabolism
    MPQ_0279 (hisD)
Enzymes [BR:mep01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     MPQ_0279 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
288123..289421
Genome map
AA seq 432 aa AA seqDB search
MNIRRFSTRDVTFDADLKALLAFETAQDDQIDLVVADILRNVKQRGDAAVLEYTKRFDHL
DVAGLSSLEISQVELHSALEALPAAQREALQQAAERVRLYHEKQLMSSWSYTEDDGTLLG
QQVTPLDRVGLYVPGGKAAYPSSVLMNAIPAKVAGVEELIMVVPTPNGERNQLVLAAAAV
CGVDRVFCIGGAQAVGALAYGTETVPQVDKIVGPGNAYVAAAKRRVFGVVGIDMVAGPSE
ILVICDGKTNPDWVAMDLFSQAEHDELAQAILLSPDAEFLDKVAASAARLVEEMPRKDII
KTSLQGRGALIQVKDLEEAARISNYIAPEHLELSLDDPLAFSKKIKHAGAIFMGRDTCEA
LGDYCAGPNHVLPTSRTARFSSPLGVYDFQKRSSLIMVSAEGAQKLGKVAATLAYGEGLQ
AHARSAEYRLKK
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcgacgcttttctactcgcgatgtgacctttgatgcggatctcaaagccttg
ctggcatttgagaccgctcaggatgaccagattgatctggtggttgccgatatcttgcgc
aatgtaaaacaacgtggcgatgccgctgtgctggagtacaccaagcgctttgatcatctt
gatgtggcaggtctttcctctctggaaatctcccaagtagaactgcattccgcactggaa
gcactgccggctgcccagcgcgaggcattgcaacaagcggctgagcgcgtgcgtctttac
cacgagaagcagttgatgtcgtcctggagttataccgaggatgatggcactttgctcgga
cagcaagtcactccgcttgatcgtgtgggcttgtatgtgcctggcggcaaggcagcctac
ccttcatccgtgctgatgaatgctattccagccaaggtggcaggggtagaagaactgatc
atggtagtgccgacacccaatggtgagcgtaaccagctggtgctggctgctgcggcggta
tgcggcgtggatcgcgtgttctgtatcggtggcgcccaagccgtgggagctctggcatat
ggcaccgagaccgtaccgcaggtagacaagattgtcgggcctggcaatgcctatgtggcc
gctgccaagcgtcgcgtatttggcgtagtcggtattgatatggtggccggaccttctgaa
attctcgtgatctgtgatggcaagaccaatccggactgggtggcgatggatttgttttcg
caagccgagcacgacgagcttgcccaggccattttgttatcgcccgatgccgagtttctc
gacaaggtcgccgccagtgcagcacgtctggttgaagagatgccgcgcaaggacatcatc
aagacatcgctgcaaggccgtggcgcgctgattcaggtgaaggatctggaagaagccgct
cgcatcagcaattacatcgctccggagcacttggagctttcactggatgatcctctggcc
ttcagcaagaagatcaaacacgccggtgccatctttatggggcgtgatacctgcgaagca
ctgggggattactgtgcgggacctaatcacgtgttgcctacttcacgtacggccagattt
tcttcgccgcttggtgtgtacgatttccagaagcgctccagcctgatcatggtatcggcc
gaaggtgcgcaaaaactgggcaaagtggccgctacccttgcgtatggcgaaggcctgcaa
gcacacgcccgttctgcggagtaccggcttaaaaaatga

DBGET integrated database retrieval system