KEGG   Methylovorus sp. MP688: MPQ_0389Help
Entry
MPQ_0389          CDS       T01361                                 

Definition
aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
mep  Methylovorus sp. MP688
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mep00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MPQ_0389
Enzymes [BR:mep01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     MPQ_0389
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
383468..384418
Genome map
AA seq 316 aa AA seqDB search
MQSIQQLNARYGVGQKIHFYSDQNGLVTVHIENPHASAKIALQGAHVMEWQPHHSEEPVL
WLGGEGGFEPVLWLSDQARFVRGRSIRGGVPVCWPWFGAHATDESLCPHGFARVAQWKIV
DTVIDPDGATRIIMQLIETQQLGKQWPHHCEVTLTVIVGSALRMQLTTTNTGTAPFVLGE
ALHTYFHVSDIEVIKISGLDNTQYQDKVEGYAVKQQQGDIRFTEETDRVYINTENTCVIE
DPGLRRRITVQKSGSKSTVVWNPWGQKAAEIGDLGSHSGWRHMVCVESANATDNVVTVAP
GEVHTLEVEYSTEYYL
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgcaatccatacagcagttgaatgcgcgttacggcgttggccagaaaatccatttctat
tccgatcagaatggtctggtaacggttcatattgaaaacccccatgcctcggccaagatc
gccctgcaaggcgcgcatgtcatggagtggcaaccccatcactctgaagagccggtattg
tggctggggggggagggggggtttgagccggtattgtggctgtcggatcaggcgcgtttt
gttcgtggccgttcgattcgcggtggggtgccggtctgctggccctggtttggtgcacat
gccaccgatgaatccctctgtccgcacggttttgcccgcgtggcccagtggaaaatcgtc
gataccgtcattgatccggatggcgccacgcgcatcatcatgcagctcattgaaacccag
cagctcggcaagcaatggccgcatcactgtgaagtcaccctcacggtgattgtcggctcc
gccctgcggatgcaacttactaccaccaataccggtaccgcaccgtttgtgctgggtgag
gcgttgcatacctattttcatgtcagcgatattgaagtcatcaagatcagcgggctggat
aacacccagtatcaggacaaggtggaaggctatgccgtcaagcagcagcagggcgacatc
cgctttacggaagaaaccgatcgggtctatatcaataccgagaatacctgtgtgattgaa
gatccgggcctgcgccgccgcattaccgtgcagaagtccggcagcaaatcgaccgtggta
tggaacccctggggacagaaagccgccgagatcggcgatctgggcagccattcgggctgg
cgccacatggtgtgcgtggagtcggccaatgcgactgacaatgtcgtcaccgttgcaccg
ggcgaagtccatacgctggaggtggaatacagcaccgaatattacctctag

DBGET integrated database retrieval system