KEGG   Methylovorus sp. MP688: MPQ_0476Help
Entry
MPQ_0476          CDS       T01361                                 

Gene name
murE
Definition
UDP-N-acetylmuramyl-tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
mep  Methylovorus sp. MP688
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:mep00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:mep00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
476581..478014
Genome map
AA seq 477 aa AA seqDB search
MTILASLHDLGIRPSSLTSDSRKVTAGSLFVAYPGDAADGRAYIPQAIANGAGAVLWEAE
GFSWPTDLQAVNLPVKDLRKQAGEIADEFYGHPSRALWMVGVTGTNGKTSCTQWLTHCLN
SLQRKTAVIGTLGNGFPGELATAINTTPDPIVLHGLLAEYLKQGAVATAMEVSSHGLDQG
RVNGVHFDVAVFTNLTRDHLDYHGDMDSYAAAKRRLMEWPGLKLAVLNAEDAYGLTFLQA
LRSEGRPVLSYGMQSGDVHSTSLHLHETGMQMSVTTPWGDVTLQASVMGRFNAYNLLAVL
ATLLAMDVPLEAAAQAIATLKPVPGRMEQYGGNAMPVVVIDYAHTPDALENALQALREQT
RGKLWCVFGCGGDRDAGKRPMMGAIASRLADHVVVTSDNPRSENPDTIIADITASMGRNH
QIMVDRRAAIAHAIEQAAPGDIVLVAGKGHETYQEIKGVRHPYSDVDVVTTLLGAVA
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaccatccttgcctcccttcatgatctcggcatacgcccaagcagcctgacttccgat
agccgcaaggtgacggcgggcagtctttttgtggcttaccctggtgacgctgccgatgga
cgggcctatattccgcaggcgattgccaatggcgctggcgccgtattgtgggaggccgaa
ggctttagctggccgactgatctgcaggccgtcaatctgccggtgaaagacttgcgcaag
caggccggcgagatcgccgatgaattctatggtcacccttcccgcgcgttgtggatggtg
ggggtgaccggtactaacggcaagacctcctgcacgcagtggctcacccattgcctgaat
agcctgcagcgcaaaaccgctgtcatcggtaccttgggcaatggtttccccggggagctt
gctactgccatcaataccacgccggaccctattgtgttgcacggtctgctggccgagtac
ctgaaacagggcgcggtagccaccgccatggaagtctcctcgcatgggctggaccagggg
cgcgtcaatggcgtgcattttgatgttgccgtgtttaccaacctcacgcgcgaccatctg
gattatcacggcgacatggacagctacgctgccgccaagcgccgtctgatggagtggcct
ggcctcaagctggcggtattgaacgcagaagatgcctacgggctgacctttttgcaggcg
ctgcgctccgaagggcgcccggtgttgagttacggcatgcaaagcggcgatgtgcattcc
accagcctgcatctgcatgaaaccggcatgcaaatgtcggtgacgacgccttggggggat
gtgacgctgcaagcttcagtcatgggccgatttaatgcctataacctgctcgccgtgctg
gcgaccctgctggcaatggatgtgccgctggaggctgccgcgcaagccatcgctaccttg
aagcccgtgccaggacgcatggagcaatacggtggcaacgccatgcccgtggtggtcatt
gattacgcccatacacccgatgccctggaaaacgcattgcaggctctgcgcgagcaaacc
cgcggcaagctctggtgcgtgtttggttgcggtggtgatcgcgatgccggcaagcggcca
atgatgggtgccattgccagccgtctggccgatcacgtcgtggtcaccagcgacaatccc
cgcagcgaaaacccggacaccatcattgccgacattaccgccagcatgggtagaaatcac
cagatcatggtggatcgtcgtgctgcgattgcccacgccattgagcaggccgcaccaggg
gacatcgtgctggtggcaggcaagggacatgaaacgtatcaggaaatcaaaggcgttcgg
catccgtatagcgatgtcgatgtcgtcacaacattattaggagccgtcgcatga

DBGET integrated database retrieval system