KEGG   Methylovorus sp. MP688: MPQ_0610Help
Entry
MPQ_0610          CDS       T01361                                 

Gene name
dsbG
Definition
thiol:disulfide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
mep  Methylovorus sp. MP688
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
611860..612582
Genome map
AA seq 240 aa AA seqDB search
MIKKLMGMMLVAAFSLNVHADEASLRKAIEATYPKVRVESITKTSYAGLYEVFLDGQIIY
TDDKFSFLIADGRLIEPKSKRDVTGERLDELTKVDFSSLPLDQAIKVVKGNGSRKLVVFS
DPDCPYCKRLEQKELVNINDVTIYTFLFPLEQLHPDAVNKSKAIWCATDRAKAWQDWVLN
GQLAKAGNCDTSAIDKSAELGRKLGVVSTPTLIFADGKRMLGAYPAKDIEKAMSTTPAKK
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaagttgatgggaatgatgctggttgcggcgttcagcctgaatgtgcacgcc
gatgaagccagcctgcgcaaggcgattgaagcgacgtatcccaaagtgcgcgttgaaagc
atcaccaaaaccagctatgccggcttgtatgaagtatttctggatggtcagattatctat
accgacgacaaattcagctttctgattgcggatggccgtcttatcgagcccaagtccaag
cgtgatgtgactggcgagcgtctggatgaactgaccaaggtggatttctcttccttgccg
ctggatcaggccatcaaggtcgtcaagggtaatggcagccgcaagctggtcgtattttct
gaccccgactgcccttattgcaaacggcttgagcaaaaagagctggtgaatatcaacgat
gtcacgatctacaccttccttttcccgctggaacaattgcatcctgatgcggtgaacaaa
tccaaggccatctggtgcgctactgatcgcgccaaggcctggcaggattgggtgttgaat
ggtcagctggccaaagccggtaactgcgatacctctgcgattgataaatccgccgagctt
ggtcgcaaactgggcgtggtgagcacccccaccctgattttcgccgatggcaaacgcatg
ctgggtgcctatcctgccaaggatattgaaaaagccatgagcaccacaccggccaagaaa
taa

DBGET integrated database retrieval system