KEGG   Methylovorus sp. MP688: MPQ_0691Help
Entry
MPQ_0691          CDS       T01361                                 

Gene name
aceF
Definition
pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mep  Methylovorus sp. MP688
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:mep01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mep00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mep00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mep00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(689401..690726)
Genome map
AA seq 441 aa AA seqDB search
MAIKEVLVPDIGNFDSVDVIEVLVKAGDTVAKDDSLVTLESDKASMDIPAPFGGVVKEVS
IKVGDKAAQGTLILTLDAAEEQATAAKPAPAPTAPPVVTSVQEQAVPAPSRPVAEPPKVI
QPQATPNPIAASTAAAPGKLAHASPSIRKFARELGVNLSLVSGSGPKNRILQSDVQAYVK
AQLAKPQSSSAAGGIAVSQAPVIDFSQFGSIEQKPMSRIKKLSGANLHRNWVTAPHVTQF
DEADITDLEDFRKSMQDEAAKRGVKLTMLAFLMKAVVNALRTYPNFNSSLSPAGDELILK
QYYHIGFACDTPDGLVVPVIRDVNQKDVLDIARDLADLSAKARERKLKIEEMQGGCFTIS
SLGGIGGTAFTPIINCPEVAILGVSRSSFQPVYDPKTKGFEPRLILPLSLSYDHRVIDGA
DGARFTSHLRMMLSDVRRLLL
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcaaggaagtactcgtccccgatatcggcaattttgatagcgtagatgtcatc
gaagtgctggtcaaagctggcgacaccgtcgccaaggatgactcgctggtgaccctggaa
tccgacaaggcctccatggacattcccgcgccatttggcggggtagtcaaggaagtcagc
atcaaggtaggtgacaaggctgctcagggcacattgatcctgacgctggatgccgcagag
gaacaggcgaccgcagccaagcctgcaccagcgccaacggcaccacccgtggtgacctcg
gtacaggagcaggccgtgcctgcgcctagccgtcccgtcgctgagccacccaaggtgatc
cagccgcaagccacgcctaatccgattgccgccagcacagcggctgcgccgggcaaactg
gcccatgccagcccttccatccgcaagtttgcgcgcgagctcggcgtcaacctgtcactg
gtcagcggcagcggaccgaaaaaccgcatcctgcaaagcgatgtgcaagcctatgtaaaa
gcccaactggccaagccgcaaagcagtagcgccgccggtggcattgccgtttcacaggcg
ccagtcattgatttcagccagttcggcagcatcgagcaaaagccgatgtcgcgcatcaag
aagctgtcaggtgccaacctgcatcgcaactgggtgaccgcaccgcacgtcacacaattc
gacgaagccgacatcaccgatctggaagacttccgcaagtccatgcaggatgaagcagcc
aagcgcggcgtcaagctgaccatgctggccttcctgatgaaggccgtggtcaacgccctg
cgcacttaccccaacttcaattcctcgctctctcctgctggcgacgagttgatcctcaag
cagtattaccacatcggttttgcctgcgacacgccggatggcctggtcgtgcccgtcatc
cgtgatgtgaaccagaaagatgtgctggatattgcccgtgatctggctgacctgtctgcc
aaggcacgcgagcgcaaactcaagatcgaggaaatgcaaggtggttgcttcacgatttcc
agcctgggtggtatcggtggcacggcgttcacgcccatcatcaattgccctgaagtagcg
atcctgggcgtgtcacgttccagcttccagccggtgtatgaccccaagaccaaaggcttc
gagccgcgtctgatcctgccgttgtcattgtcttacgaccaccgcgtgatcgatggcgcc
gatggcgcacgctttaccagccacctgcgcatgatgctgtccgacgttcgccgtctcttg
ctgtaa

DBGET integrated database retrieval system