KEGG   Methylovorus sp. MP688: MPQ_0702Help
Entry
MPQ_0702          CDS       T01361                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mep  Methylovorus sp. MP688
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mep00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MPQ_0702 (tpiA)
   01230 Biosynthesis of amino acids
    MPQ_0702 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MPQ_0702 (tpiA)
   00051 Fructose and mannose metabolism
    MPQ_0702 (tpiA)
   00562 Inositol phosphate metabolism
    MPQ_0702 (tpiA)
Enzymes [BR:mep01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MPQ_0702 (tpiA)
Exosome [BR:mep04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MPQ_0702 (tpiA)
  Exosomal proteins of bladder cancer cells
   MPQ_0702 (tpiA)
  Exosomal proteins of melanoma cells
   MPQ_0702 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
703040..703795
Genome map
AA seq 251 aa AA seqDB search
MRRKLVVANWKMHGDLAQNKVLFDAFRQRLDHLTSADFAVCVPYPYLFQAQQELQGSHIA
WGAQNVAKHEVGAYTGEVSARMLKDFGASYVIVGHSERSTAYCESDENIAAKFVVARKSG
ITPVLCLGETLAERESGLCHQVIASQIDAVLKTVGAGVFAHAVVSYEPVWAIGTGLSATP
EQAQQVHAFIRDRIAALDVHAAETVRILYGGSVNPLNASQLFVMPDIDGGLIGRCSLNAN
DFEEICRAACQ
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgtaagctggtggtcgctaattggaaaatgcatggcgaccttgcgcaaaacaag
gtgctgtttgatgcattcaggcagcggcttgatcatttgacctcggccgattttgcggtc
tgtgtgccatacccttatctgtttcaggcgcagcaggagctgcagggcagccatattgcc
tggggcgcccagaatgttgccaagcatgaagtcggagcatacaccggagaagtcagtgcg
cgcatgctcaaggactttggtgccagttatgtgatcgtggggcattccgagcgcagtacc
gcctattgcgaaagcgacgagaatattgccgccaaatttgtggtggcgcgcaaatcgggc
atcacgcctgtgctttgcctgggagaaaccctggccgagcgcgagtccggtctgtgtcat
caagtcattgccagccagattgatgccgtactgaagacggtgggggctggcgtgtttgca
catgccgttgtttcctatgaaccggtatgggctatcggcacgggtttatctgcaacaccg
gagcaggcacagcaggtacatgcgtttatccgtgatagaatcgccgcgctggatgtgcat
gcggcagaaaccgtaagaattctgtatgggggtagcgtaaatcccctaaatgcgtcacaa
ttattcgttatgccggatatagacggcggtttgattggcagatgttcattgaatgccaac
gattttgaggaaatttgtcgcgctgcttgtcagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system