KEGG   Methylovorus sp. MP688: MPQ_0867Help
Entry
MPQ_0867          CDS       T01361                                 

Definition
phosphoglucomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
mep  Methylovorus sp. MP688
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mep00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MPQ_0867
   00030 Pentose phosphate pathway
    MPQ_0867
   00051 Fructose and mannose metabolism
    MPQ_0867
   00052 Galactose metabolism
    MPQ_0867
   00500 Starch and sucrose metabolism
    MPQ_0867
   00520 Amino sugar and nucleotide sugar metabolism
    MPQ_0867
  Nucleotide metabolism
   00230 Purine metabolism
    MPQ_0867
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MPQ_0867
Enzymes [BR:mep01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     MPQ_0867
    5.4.2.8  phosphomannomutase
     MPQ_0867
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(861842..863215)
Genome map
AA seq 457 aa AA seqDB search
MLAPKEIFKAYDIRGIVGKTLTPEIVEQIGKAIGSEAAKLQQKAICIGYDGRLSGPELAE
ALARGILSTGVDVIRLGLVATPMVYFAAHQLKTGCGVMVTGSHNPPDYNGLKMVIAEETL
SGESIQRLRTRIEQQDFASGSGKASDYDIADDYINRIASDIKLSRPMRIAVDCGNGVPGA
YAGKLYRALGCEVEELFCEVDGHFPNHHPDPSVPENLLDLIAALGKGSSEIGLAFDGDGD
RLGVVTKDGKIIYPDRQLLLFAEDVLQREPGATIIYDVKSSRNLAPWIKARGGLPLMWKT
GHSLVKAKMKETGSALAGEMSGHVFFKERWFGFDDGLYSGARLLEILSRSSDPSALLNAL
PDSVSTPEQHIHMNEGEPHALIASLQKTAEFAGATEVITIDGLRVEYPDGFGLMRPSNTT
PVIVLRFEADDEAALRRIQEAFRSVILAAAPHVHLPF
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgcttgcaccaaaagagattttcaaggcttacgatatccgcggtattgtcggtaaaaca
ttgactcccgagattgtcgagcaaatcggcaaggcaatcggtagcgaggctgccaaactg
cagcaaaaagccatttgcataggctacgatggccgcctctccggccccgagctggcggaa
gccctggcacgcggcattctcagcacaggggtggatgtcatacgcctgggcctggtggca
acgcctatggtgtattttgccgcgcatcagctcaagaccggctgtggcgtcatggtcacg
ggcagccacaatccgcctgactacaacggcctgaagatggtgatcgccgaggaaaccctt
tctggcgagagcatccagcgtttgcgcacccgcattgagcaacaggactttgccagcggc
agtggcaaggccagtgattacgacattgccgatgactacatcaaccgcattgcctctgac
atcaagctgagccgccccatgcgcattgccgtcgattgcggcaatggtgtgcctggcgcc
tacgcgggcaagctctaccgcgctctgggttgcgaggtggaagagctgttctgcgaggtc
gatggccacttccccaaccatcaccctgatccttccgtgccggaaaacctgctggatctg
attgccgccctcggcaaaggcagctccgaaatcggcctggcattcgatggcgatggggac
cgcctgggcgtggtcaccaaggatggcaagatcatctaccctgatcgtcagctgctgctg
tttgcagaagatgtcctgcagcgcgaacccggcgccaccatcatttatgacgtgaaatcc
tcacgcaacctcgcgccttggatcaaggcacgcggcggtttgccactgatgtggaaaacc
ggccactcgctggtgaaggcaaaaatgaaagaaaccggctccgccctcgcaggcgaaatg
agcggccatgtattcttcaaggagcgctggttcggttttgatgatggcctctacagcggc
gcgcgcctgctggaaatcctcagccgctcgtccgacccttccgcgctgctgaatgcattg
ccagacagcgtcagcacgcctgagcaacacatacacatgaatgaaggcgagccgcatgcg
ctgatcgccagcctgcaaaagaccgctgaattcgcgggcgccaccgaagtcatcaccatt
gatggtctgcgcgtggaatacccggacggctttggtctgatgcgcccatccaacaccacc
ccggtgatcgtgttgcgctttgaagccgatgacgaagccgcactgcgccgtattcaggaa
gccttccgcagtgtgattctggcggcagcgccgcacgtgcatctgcctttttaa

DBGET integrated database retrieval system