KEGG   Methylovorus sp. MP688: MPQ_0911Help
Entry
MPQ_0911          CDS       T01361                                 

Definition
class I/II aminotransferase
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
mep  Methylovorus sp. MP688
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mep00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    MPQ_0911
   01230 Biosynthesis of amino acids
    MPQ_0911
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MPQ_0911
   00290 Valine, leucine and isoleucine biosynthesis
    MPQ_0911
Enzymes [BR:mep01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     MPQ_0911
    2.6.1.66  valine---pyruvate transaminase
     MPQ_0911
Amino acid related enzymes [BR:mep01007]
 Aminotransferase (transaminase)
  Class I
   MPQ_0911
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
907937..909178
Genome map
AA seq 413 aa AA seqDB search
MDPLLKSSKLNNVCYDIRGPVLARAREMEEDGHRIIKLNIGNPAPFGFEAPEEILQDVIH
NMDQASGYTDSKGLFAARKAIMHYTQQKNIAGVTIDDIIIGNGVSELIVMAMQALLNNGD
QVLVPMPDYPLWTAAVTLAGGTARHYLCDENTGWLPDLKDIESKITANTRGIVIINPNNP
TGALYPRETLEGIIEIARHHGLVIFADEIYDKVLYDGNTHTSIASLADDVLFVTFNGLSK
NYRTCGYRAGWLVVSGEKRHAGDYIEGLNMLASMRLCANVPGQLAIQTALGGYQSINDLV
APGGRLCKQRDLAYELLTAIPGVTCEKPAAAMYLFPRLDPKIYPIKDDQQFILDLLLEEK
VLLVQGSGFNWKKPDHFRVVFLPNVDDLTEAIKRIARFLEGYRKKHGTDKISA
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
gtggatccattactcaagtcttccaaactcaataacgtgtgctacgacattcgcggcccg
gtattggcgcgcgcgcgcgaaatggaagaagacggccaccgcatcatcaaactgaatatc
ggcaacccggcgccgtttggttttgaagcacccgaagagattctgcaggacgtgatccac
aatatggatcaggcgtccggttacaccgactccaagggcctgtttgccgcccgcaaagcc
atcatgcactacacccagcagaagaatattgcgggtgtgaccatcgatgacatcatcatc
ggcaatggcgtgtccgagctcatcgtcatggcaatgcaggcactgcttaataatggcgac
caggtgctggtgcccatgcccgactatccattgtggacagcggctgtcaccctggctggt
ggtactgcccgccactacctgtgcgatgaaaacaccggctggttgcctgatctcaaggac
attgagtccaagatcaccgctaacacgcgcggcattgtcatcatcaacccgaacaacccg
accggtgcgctttatccgcgtgaaacgctggaaggcattatcgaaatcgcccgccatcac
ggcctggtgatttttgctgacgagatttacgacaaggtgctgtatgacggcaacacgcac
acctccatcgcctcactggccgatgatgtgctgtttgtgaccttcaacggcttgtccaag
aattaccgtacctgcggctaccgtgctggctggctggtggtgtccggtgaaaaacggcat
gctggtgattatattgaaggcttgaacatgctggcctccatgcgcctctgtgccaacgtg
ccgggacaattggccatccagaccgcgctgggcggctatcagagcatcaatgatctggtg
gccccgggcggacgcctttgcaagcagcgtgacctcgcgtatgagttgctgacggcgatt
cccggtgtcacctgtgaaaagccagcggcggccatgtacctgttcccgcggctggacccc
aagatttacccgatcaaggatgaccagcagttcattcttgacctgttgctggaagaaaaa
gtcctgctggtgcagggcagtgggttcaactggaaaaaaccggatcatttccgcgtggtg
ttcctgcccaatgtggatgacctgaccgaagcgatcaagcgtattgcccgcttcctcgaa
ggctatcgcaagaagcacggcacagacaaaatcagcgcataa

DBGET integrated database retrieval system