KEGG   Methylovorus sp. MP688: MPQ_0913Help
Entry
MPQ_0913          CDS       T01361                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mep  Methylovorus sp. MP688
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mep00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MPQ_0913 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MPQ_0913 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MPQ_0913 (thrC)
Enzymes [BR:mep01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MPQ_0913 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
910564..911997
Genome map
AA seq 477 aa AA seqDB search
MKYISTRGQSPALSFTEILLGGLAPDGGLYLPEQYPQLSDADLTRLRGMNYRDLAFSILS
LLADDIPPADLRAIVDKTYRADVYAYARPEQNAEDITPTLKLEDNLYLLSLSNGPTLAFK
DMAMQLLGNLFEYVLAKKGETTNILGATSGDTGSAAEYAMRGKKGVKVFMLSPHKKMSRF
QTAQMFSLQDENIFNIAVNGVFDDAQDIVKAVSNDAAFKARNKIGAVNSINWARVAAQVV
YYFKGYFAVTRSNTEKVSFAVPSGNFGNVCAGHVARMMGLPIDKLVVATNENDVLDEFFK
TGVYRPRGSANTYHTSSPSMDISKASNFERFVFDLTGRDAAKVRALWSKVDQGGAFDLNE
DGLFAQVADYGFVSGSSNHAARMQTIRETQAKYGVTIDTHTADGLKVALQVRDPATPMLV
LETALPVKFEDAIQEALGHKPERPASLQGLEDLPQRFEVMDADVQAIKQFIVDHTAD
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacatcagtacccgcgggcagtcgcctgcactctcgtttaccgaaatcctgctg
ggtggtctggcgccggacggcggcctgtacttgcccgagcaatatccacagctgagcgat
gcggacctgacacgcctgcgcggcatgaattaccgcgatctggcattcagcattctttcg
ctgctggcggacgatattccgccagcggatctgcgcgcgattgtcgacaagacctaccgt
gccgatgtgtatgcctatgcgcggcctgagcaaaatgccgaggacattaccccgacgctg
aagctggaagacaatctctatttgctgtccctgtccaacggcccgacgctggccttcaag
gatatggccatgcagttgctgggcaatctgtttgaatatgtgctggcgaaaaaaggcgag
accaccaatattctgggtgccacctccggcgacaccggctccgcggctgaatacgccatg
cgcggcaaaaaaggcgtcaaggtgttcatgttgtcaccgcacaagaaaatgagccgcttc
cagaccgcccagatgttcagcctgcaggatgagaacattttcaatatcgccgtcaacggc
gtgtttgatgacgcgcaggatatcgtcaaggcagtgtccaatgacgccgcgttcaaggcc
aggaacaagatcggtgcggtgaactccatcaactgggcacgcgtcgcggcgcaggtggtg
tattacttcaagggctactttgccgtgacccgcagcaacacggaaaaagtgagctttgcc
gtgccttccggcaattttggcaacgtgtgtgccggccatgtggcgcgcatgatgggcttg
cctatcgataaacttgtggtcgccaccaatgaaaacgacgtgctggacgagttcttcaaa
actggcgtgtaccgtccgcgtggctcggccaatacctaccacacctccagtccttccatg
gacatcagcaaggcctccaactttgagcgctttgtgtttgatctcaccgggcgcgatgcc
gccaaggtgcgtgccctgtggagcaaggtagatcagggcggtgcctttgatctgaatgaa
gacggcctgtttgcccaggtagccgattacggctttgtctcgggcagcagcaatcatgca
gcccgcatgcagaccatacgtgagacacaagccaagtatggtgtgaccattgatacccac
accgctgatggtctgaaagtcgcgttgcaagtgcgcgaccccgccacccccatgctggtg
ctggaaacggcattgccggtcaagtttgaagatgcgattcaggaagccctgggccacaag
ccggagcgcccggccagcctgcaaggcctggaagatttgccgcagcgctttgaggtgatg
gatgccgatgtgcaggccatcaagcaattcattgtcgaccacaccgccgattag

DBGET integrated database retrieval system