KEGG   Methylovorus sp. MP688: MPQ_0922Help
Entry
MPQ_0922          CDS       T01361                                 

Gene name
folA
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mep  Methylovorus sp. MP688
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:mep00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MPQ_0922 (folA)
   00670 One carbon pool by folate
    MPQ_0922 (folA)
Enzymes [BR:mep01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     MPQ_0922 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
918939..919427
Genome map
AA seq 162 aa AA seqDB search
MPKLSLIVAIAHDGVIGVNNTLPWHLPEDLKRFRALTMGHHIIMGRKTYESLNRLLPGRT
TVIVTRNADYRVEGALVSSSLEDALAQSAGDDEVFLIGGAELYREGLAKADQLYITEIDA
HFEGDAFFPQMDRGQWQLIEEERHVSEQGLPFRYLTYRRNAA
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaactctctcttatcgtagccatcgcgcatgatggcgtcatcggggtcaataat
accctgccttggcatttgcccgaagacctcaagcgctttcgcgccttgaccatgggccat
catatcatcatgggccgaaaaacctatgagtcactgaaccgcctgttgccgggccgcacc
accgtcattgtcacgcgcaatgcggactatcgggttgaaggcgcactggtgtccagctcg
ctggaagatgcccttgcacagtcggcaggcgatgatgaggtgttcctcatcggtggtgca
gaactttaccgtgaaggtcttgccaaagcggatcagctctacattacggaaattgatgcc
cactttgaaggcgatgctttttttccgcagatggatagggggcaatggcagctcatcgaa
gaggagcgccatgtcagtgaacaaggcttgccattccgctatctgacttacagacgcaac
gcagcctaa

DBGET integrated database retrieval system