KEGG   Methylovorus sp. MP688: MPQ_0969Help
Entry
MPQ_0969          CDS       T01361                                 

Gene name
argE
Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mep  Methylovorus sp. MP688
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:mep00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MPQ_0969 (argE)
  Amino acid metabolism
   00300 Lysine biosynthesis
    MPQ_0969 (argE)
Enzymes [BR:mep01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     MPQ_0969 (argE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(967380..968507)
Genome map
AA seq 375 aa AA seqDB search
MSKTLDLAQDLIARRSVTPEDLGCQELLISRLEPLGFKIERMRFGDVDNFFARRGTASPL
LVFAGHTDVVPTGPVDQWHTPPFEPTIKDGMLYGRGAADMKTSLAAFITSIEEFVARHPD
HQGSIGLLITSDEEGIATHGTVKVVEALKARGELIDYCIVGEPTSSKVVGDMIKNGRRGS
LSGKLVVKGVQGHIAYPHLVKNPIHLVAPAIKELADTVWDSGNEYFPPTSWQISNMNGGT
GATNVVPGEVTIQFNFRFSTASTAEGLREGVHAILDKHALEYDLQWELSGKPFLTPKGTL
VEAISAAIETAFGVTPELSTSGGTSDGRFIADIASQIVEFGPLNATIHKLNECVGVADIE
PLKDAYRLTMETLLT
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaccctagacctggcccaggacctgattgcccggcgctcggtcacgccagaa
gacctgggttgccaggaactgctgatttcgcggctagaaccgctgggtttcaaaattgag
cgcatgcgctttggcgatgtcgacaatttctttgcgagacgcggcaccgcaagcccgcta
ctggtcttcgcaggccataccgatgtggtgcctaccggcccggtcgaccaatggcatacc
ccgccctttgagcccaccatcaaggatggcatgttgtatgggcgcggcgcggccgacatg
aaaacctcgctggcggcgtttattacctccattgaggaatttgttgcccggcatccggat
catcaaggctcgattggccttctgatcacgtcagatgaggaaggcattgccactcatggc
acggtcaaggtcgttgaggcgctgaaagcccgcggcgagctgattgattactgcatcgtc
ggcgaacccacctccagcaaagtcgtcggcgacatgatcaagaatggccgccgcggttcg
ctctccggcaaactggtcgtcaagggcgtgcaaggccacatcgcctacccgcatctggtc
aaaaatcccattcacctggtagccccggcaatcaaggagctggccgacaccgtgtgggat
agcggcaatgaatacttcccgcccacttcctggcagatctccaatatgaacggcggcact
ggcgccaccaatgtggtgccgggtgaagtcaccatccagttcaacttccgcttttcaacg
gcgagcacggcagaaggcttgcgcgagggcgtgcatgccattctggacaagcacgcactg
gaatacgacctgcaatgggagctttccggcaagcccttcctcacgcccaagggcacgctg
gtcgaagccatcagcgccgccattgaaaccgcctttggtgtcacgccggaactctcgacc
agcggtggcacctccgatggtcgcttcattgccgatattgccagccagatcgttgaattc
ggcccattgaatgccaccatccacaaactgaatgaatgcgttggcgtggccgatatcgag
cccttgaaagacgcctaccgcctgactatggaaaccctgctgacatga

DBGET integrated database retrieval system