KEGG   Methylovorus sp. MP688: MPQ_1010Help
Entry
MPQ_1010          CDS       T01361                                 

Gene name
bglX
Definition
glycoside hydrolase family 3 domain-containing protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mep  Methylovorus sp. MP688
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mep00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MPQ_1010 (bglX)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    MPQ_1010 (bglX)
Enzymes [BR:mep01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     MPQ_1010 (bglX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1009476..1010531
Genome map
AA seq 351 aa AA seqDB search
MTLGPIMLDVVGTELDAADIRRLQHPLVGGVILFARNYQSPAQLKALTASIHAVRQPPLL
IGVDHEGGRVQRFREGFTRIPPMREFGKIWDKQPKKAKQLAEEAGWLMAVELRAHGIDFS
FTPVLDMDYGVSQVIGDRAFHMQPQAIAELAYALMQGLKRGGMAAVGKHFPGHGYIAADS
HVAIPVDERSFDEIASTDMQPFRQMIDDGLPAIMPAHVIYPKVDDKPAGFSERWLQKVLR
QRLAFNGVIFSDDLSMEGAVVAGNVTQRALAALNAGCDMALLCNRPDLADELLENLQWNI
SAPSLARLARMHGKLHPADMTALRESHEYIDAVHTISQIGIHEDDMFAEAS
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgacattaggcccgattatgctggatgtggttggcaccgaactggacgccgccgacatc
cgccgtttgcaacacccgctggtgggcggggtgatcctgttcgcccgcaactaccagtcg
cccgctcaactgaaagccctcaccgccagcattcatgccgtgcgccagccgcccttgctg
ataggcgtggaccatgagggcggccgcgtgcaacgtttccgcgagggctttacccgcatt
cctcccatgcgcgaattcggcaagatctgggacaaacaaccgaaaaaagccaagcagctg
gccgaagaagcaggctggctgatggccgtggagctgcgtgcccatggcattgatttcagc
tttacgccagtgctggatatggattacggcgtcagccaggtgatcggcgatcgcgccttt
cacatgcagccacaagccattgccgagctcgcgtatgcgctgatgcaaggcctcaaacgt
ggtggcatggcggcagttggcaagcatttccccggccatggctacattgctgcggattcc
catgtggcgattccggtggatgaacgcagctttgacgagattgcctctaccgacatgcaa
cctttccgccagatgattgatgacggcttgcccgccatcatgcctgcgcatgtgatctac
cccaaggtggacgacaagcccgctggcttctcggagcgctggctgcagaaggtcctgcgg
caacgtctggcgttcaacggcgtgattttcagcgatgatctgtcgatggaaggcgcggtg
gtggcgggcaatgttacccagcgtgcgctggccgcactgaatgccgggtgtgatatggcc
ttgctgtgcaatcgtcccgaccttgccgatgagctgcttgaaaatcttcagtggaatatt
tcggcacccagtctggcacggctcgcccgcatgcatggcaaactgcatccggctgacatg
acggccctgcgcgaaagccacgagtatatcgatgcggtgcataccatcagccagatcggc
attcatgaggatgacatgttcgccgaggcttcctga

DBGET integrated database retrieval system