KEGG   Methylovorus sp. MP688: MPQ_1026Help
Entry
MPQ_1026          CDS       T01361                                 

Gene name
pcm
Definition
protein-l-isoaspartate o-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mep  Methylovorus sp. MP688
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1023280..1023948)
Genome map
AA seq 222 aa AA seqDB search
MSSVIRGIGMTSLRTRERMLARLREQGIRDEVTLSAMGSIARHIFVDEALSSRAYEDVSL
PIGFGQTISQPYIVARMTEILRAGKPLGNVLEIGTGCGYQTAVLSKVAKEVYSVERIRPL
LMKARGHLRELRMSNIKLKHADGTMGLSEMAPFDGIIVTAAASHVPQELLEQLAVGGRMV
IPVGTEEQILYLIEHVATTNGSEYRQTKLEPVKFVPLLGGTN
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtaatccgtggcataggcatgacctctcttcgtacgcgtgagcgcatgctg
gcgcgtctgcgtgagcaaggcatacgcgatgaagtcaccctttccgccatgggcagcatt
gcccgccatatttttgtcgatgaggctttgtcctctcgcgcctatgaagatgtgtccttg
cctatcggtttcggccagaccatctcccaaccgtatatcgtcgcccgcatgacggaaatc
ctgcgtgctggcaaaccactgggcaacgtgcttgaaatcggcactggctgcggctatcag
accgccgtgctctccaaggtggcaaaagaagtctactcggtggagcgcatacgccccctg
ctgatgaaagcccgcggccacttgcgcgagctgcgcatgagcaacatcaagctcaagcat
gcggatggcaccatggggctatctgagatggcaccattcgatggcattattgtcacagcg
gctgccagccatgtaccgcaggagctgctggaacagctggcggtaggcggacgcatggtg
atcccggtgggcaccgaagaacaaatcctctacctgattgaacatgttgccaccaccaat
ggcagcgaataccggcaaaccaagctcgagccggtgaagttcgttcccctgctgggcgga
acgaattga

DBGET integrated database retrieval system