KEGG   Methylovorus sp. MP688: MPQ_1068Help
Entry
MPQ_1068          CDS       T01361                                 

Gene name
phoA
Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
mep  Methylovorus sp. MP688
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mep00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:mep00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:mep02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1064640..1066634)
Genome map
AA seq 664 aa AA seqDB search
MKSPRFALNCVRAVVAATLGVAASVSVAAPTVTRLTPPSERFATGVNDPSAPMIARFLPG
QRFDLQATIRPDAGATITGFQFAVDGVTVPVTASTSGIVTTGLNAGLPANTAVVSKRAYS
NTVPGVHTLTVKATQSDGQTVTATGSFEVVGITNQGRPAKNIIILLGDGMGAAHRTAARI
MAKGYAQGKAKGHLAMDTFPYTGMVMTSSLDTIVTDSAPGMANYVNGNKQASGQEGVWPD
DTADAFDNPRMEYLSEYLHRTQGKSLGIVTTADVFDATPAANAVHTSNRGNGTGIADQYL
DDRKLTGLTVLMGGGRKWFLPNASNSVSPQPANGSQRRAANDYVLTSDIVSGWGAAVGAK
DPARDLISDFSAAGYTYVSDKSALQSAGVPDKLLGLFAYSNMNVAFDKINGRRGVSSVVN
DYGFPDQPMLEEMTDKAIKVLAKNPKGFVLTVEGASIDKQAHLMDSDRWIEEVIEFDRAV
QVAKNFATANPDTLVIVTADHETGGASILGASKVTNAELQGKANTVASMRNEVVGTYQDA
KFPKYTIAADGYPATTDIDNKMLIGYGANADRYEAWIANAQPTQDSQQPFVGTAPLNTYP
ANPSVRNASTGYLVTGQVSGDQAVHTATDIPLSAFGRGAALFTGVMDNTDVFFKFGQAAI
GGVK
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcacctcgttttgcacttaactgtgtacgcgctgttgtagcagcgacgctgggc
gttgctgccagcgtcagtgttgccgcccctaccgttacacgcctgacaccaccgagcgaa
cgtttcgctaccggcgtgaatgacccaagcgcccccatgattgcccgcttcctgccaggt
cagcgttttgacttgcaagcgaccatccgtccagatgctggcgccaccatcaccggcttc
cagtttgccgtggatggcgtgactgtgcctgtaactgccagcacctctggcatcgttacc
actggcctgaatgctggcctgcctgcgaataccgccgtggtttccaagcgtgcttactcc
aacacggttcccggcgttcacaccctgacagtgaaagccacgcaaagcgatggccagacc
gtcaccgccactggcagctttgaagtggttggcattaccaaccagggccgtccagccaag
aacatcatcatcctgctgggtgatggcatgggtgccgcgcaccgcactgccgcccgcatc
atggccaagggttatgcccagggcaaggccaagggtcatctcgccatggataccttcccc
tacaccggcatggtgatgacatcctcactggataccatcgtcactgactccgcacctggc
atggccaactatgtgaatggcaacaagcaggcttccggtcaggaaggcgtatggccagat
gacactgccgatgctttcgacaacccacgcatggaatacctgtcggaatacctgcaccgc
actcagggcaaatcgctgggtatcgtcaccactgccgatgtatttgatgccacacctgcc
gctaacgccgtgcacacctccaaccgcggcaacggtaccggaattgccgaccaatacctg
gatgaccgcaagctgaccggcctgaccgtgctgatgggtggcggccgcaagtggttcctg
cctaatgcatccaacagtgtcagcccgcaacccgccaatggttcgcaacgccgcgctgcc
aatgattacgtgctgactagcgacatcgtcagcggctggggcgctgccgtcggtgccaag
gatccagcgcgtgacctgatcagcgacttcagcgctgccggttacacctatgtttctgac
aaatctgccctgcagagcgcaggcgtgccagacaagctgctgggcctgtttgcctactcc
aacatgaacgtggcgtttgacaagatcaacggccgtcgtggtgtttccagtgtggtaaat
gactatggcttccctgaccagcccatgctggaagagatgaccgacaaggcgatcaaggta
cttgccaagaatcccaagggtttcgtattgacagtggaaggcgcttccatcgacaagcag
gcgcacttgatggatagcgatcgctggattgaagaagtcatcgagtttgaccgtgctgtg
caagttgccaagaatttcgccacggccaacccggacacgctggtaattgtgacggccgac
cacgaaaccggtggtgcttccatcctgggtgcttccaaggtgaccaatgccgaactgcaa
ggcaaggccaacaccgtggccagcatgcgtaacgaagtggtgggtacttatcaggatgcg
aaattccccaagtacaccatcgcggctgatggctaccctgccaccaccgacatcgacaac
aagatgctgatcggttacggcgccaatgctgaccgctacgaagcctggattgccaatgcg
caacctacgcaggacagccagcagccattcgttggcaccgcaccgctgaacacttaccct
gctaacccaagcgtgcgtaatgccagcaccggttacctcgtgactggtcaggtatccggc
gaccaggccgtgcacaccgcgactgacattccattgtccgccttcggtcgtggcgctgcc
ctgttcactggcgtgatggataacaccgatgtgttcttcaagtttggtcaggctgccatc
ggcggcgtgaagtaa

DBGET integrated database retrieval system