KEGG   Methylovorus sp. MP688: MPQ_1345Help
Entry
MPQ_1345          CDS       T01361                                 

Gene name
glgB
Definition
1,4-alpha-glucan branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mep  Methylovorus sp. MP688
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:mep00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MPQ_1345 (glgB)
Enzymes [BR:mep01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     MPQ_1345 (glgB)
Exosome [BR:mep04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MPQ_1345 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1374647..1376827)
Genome map
AA seq 726 aa AA seqDB search
MPKPNKNDELSLILQAKHYNPHNVLGLHVHDGQHSFRAFLPFAEQAWLKLGHDWQPLVRG
ESDGFFEWSGQEQPETPCQLRIEQHGEIIETWDPYSFGPMLSNDELYLLGEGKLKLAYRT
LGAHLCTHQGVAGVRFAVWAPTAERVSVVGDFNQWDGRVHAMHCHGSSGVWELFIPLLTE
NQLYKFEIRNRNTGNLHVKTDPYGFSFEQLPGTASKITRLDGYQWQDDAWLKARAERDWL
HAPLNCYEVHLGSWRRDEHGHFLGYRQLAEQLIPYVQDMGYTHIELLPVSEHPLNESWGY
QTTGYFGVTNRFGSPDDFRYFVDRCHQAGIGVILDWVPGHFPKDDWALARFDGSALFEHE
DPRLGEHQDWGTYIFNYGRNEVRNFLISNAYYWLKELHIDGLRVDAVASMLYLDYSRKEG
QWLPNKFGGRENLEVIDFLRQLNMMVHEDFPGALTIAEESTSFPMVSRPVYLGGLGFSMK
WNMGWMNDTLSYMANDPIHRRYHQQKLTFGQLYAYTENFLLPFSHDEVVHGKRSLLEKMP
GDTWQKFANLRLLMTYQATISGKKLSFMGNEIGQSREWNVNASLDWHLLGEQFNQGIQRL
CRDLNHAYKNYPALHALDFEQTGFRWIDCNDAEQSTISFVRTGQAGEALVILLNFTPVPR
MQYRIGVPQAGSYRELINSDAECYGGSNMGNGGLLHSEPVPWMGCQHSIELTLPPLAGLI
LKPESA
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
ttgccaaagcccaataaaaacgatgaattatcgctgattcttcaagcgaaacattacaac
ccgcataacgtgcttggattgcatgtgcatgacgggcagcacagttttcgcgcatttttg
ccattcgccgaacaggcatggctcaaattagggcacgactggcaacctctagtccgtggc
gaatcggatggtttttttgagtggtcaggccaggaacagcctgaaacgccatgccagctc
aggattgagcaacatggggaaatcattgaaacctgggacccctattcttttggcccaatg
ctcagcaatgacgagttgtatttgctgggtgaaggcaaactcaagctggcctaccgcacc
ctgggcgcacatctgtgtacgcaccaaggggttgccggcgttcgctttgccgtatgggcg
cccaccgccgagcgcgtaagcgttgtcggggatttcaatcaatgggatggccgggttcac
gccatgcattgccatggctccagcggcgtgtgggagctcttcatccccctgctcaccgaa
aatcagctctataaatttgaaattcgcaatcgcaacaccggcaaccttcatgtcaaaacc
gacccttacggcttcagctttgagcagttgcccggcactgccagcaagatcacccggctg
gacggctaccaatggcaggacgatgcctggctcaaggcacgtgcagaacgtgattggctg
catgccccacttaactgttacgaagtgcatctcggatcctggcggcgcgatgagcacggc
catttcctcggatatcggcagttggccgagcaactgatcccttatgttcaggacatgggc
tacacccatattgagttattgccagtatccgaacaccccctcaatgaatcatggggctat
cagaccacaggctatttcggtgtcaccaaccgttttggcagtcccgatgatttccgttac
ttcgtggatcgctgtcaccaggcgggcattggcgtgattctggactgggtgcctggacat
ttccccaaagacgactgggcgctggcccgttttgatggctcggcactgtttgagcacgag
gatccgcgcctgggtgaacaccaggactggggcacgtatattttcaattacggccgcaat
gaggttcgcaacttcctgatcagcaatgcctattactggcttaaggaattgcacattgat
ggtttgcgcgtggatgccgtggcgtccatgctttacctcgactactcgcgcaaagagggc
caatggctgcccaacaagtttggcgggcgcgagaatctggaagtcatcgactttctgcgc
cagctcaacatgatggtgcatgaggattttcctggcgccctcaccatcgccgaagagtcc
acctctttccccatggtttcacgccccgtttatctgggcggccttggtttctccatgaag
tggaatatgggctggatgaacgacacgctgtcgtacatggccaatgatcctatacacagg
cgatatcaccagcaaaagctcacgtttgggcagctctatgcctatacggaaaactttttg
ctgcccttctcgcatgatgaagttgtccatggcaaacgctccttgctggaaaaaatgccg
ggcgatacctggcaaaagtttgccaacctgcgtttgctgatgacttaccaggccacgatt
tccggcaaaaaactcagcttcatgggcaatgaaattgggcaaagtcgcgaatggaatgtt
aacgcatcgctggactggcatttgcttggagagcagttcaaccaagggattcagcgcctc
tgccgtgatcttaaccatgcctataaaaactatcccgccttacacgcgctggatttcgag
cagaccggattccgctggatagactgcaacgatgccgagcaatccacgatcagctttgta
cgtacgggccaggcgggcgaagctctggttatcttgctcaacttcaccccagtgccgcgc
atgcagtaccggattggtgttcctcaggcaggcagctatcgcgagctgatcaatagtgat
gccgaatgctatggcggcagcaatatgggcaatggcggcttgttgcacagtgaacctgtg
ccctggatgggatgtcagcattccattgaacttaccttgccaccgcttgccggactgata
ttgaagcccgaatctgcataa

DBGET integrated database retrieval system