KEGG   Methylovorus sp. MP688: MPQ_1349Help
Entry
MPQ_1349          CDS       T01361                                 

Gene name
nagC
Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
mep  Methylovorus sp. MP688
Pathway
mep00010  Glycolysis / Gluconeogenesis
mep00052  Galactose metabolism
mep00500  Starch and sucrose metabolism
mep00520  Amino sugar and nucleotide sugar metabolism
mep00521  Streptomycin biosynthesis
mep01100  Metabolic pathways
mep01110  Biosynthesis of secondary metabolites
mep01120  Microbial metabolism in diverse environments
mep01130  Biosynthesis of antibiotics
mep01200  Carbon metabolism
Module
mep_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mep00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MPQ_1349 (nagC)
   00052 Galactose metabolism
    MPQ_1349 (nagC)
   00500 Starch and sucrose metabolism
    MPQ_1349 (nagC)
   00520 Amino sugar and nucleotide sugar metabolism
    MPQ_1349 (nagC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MPQ_1349 (nagC)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    MPQ_1349 (nagC)
Enzymes [BR:mep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MPQ_1349 (nagC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FGGY_N
Motif
Other DBs
NCBI-ProteinID: ADQ84510
Position
1382174..1383103
Genome map
AA seq 309 aa AA seqDB search
MFLGVDIGGTNLRVGVVQHHALIHEQRALADFSGLCARHPPDEAWRQIIATTAATLRQCL
MQYPQAKAVGIGFPGFIDPVHGTVAQSPNLPGLRNVDLAGDLSAAIGLPVVVENDALAAA
YGEYVLCDPKPHSLLYAGLGTGVGGGMIYAGRPFTGEHGVAMEIGHLIVEPGGRSCGCGN
HGCMEQYASASGIAQSYHMATGQRVEVNAIAQAAREGGQAAVEAFSLAGAALAQALAHVV
KSVDVGLIVIGGGVSQAWDLMAPAFFTRLERDMIPVLRDRLRVQPSASGDRAGIIGAAAL
AEIILASSS
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
ttgtttttaggcgttgatataggcggcaccaatctacgagtgggcgtggtgcagcaccac
gcattgattcatgagcagcgcgcactggctgacttttctggtctgtgtgcccggcacccc
ccggacgaggcatggcggcagattattgcgactacggcggctaccttgcgccagtgcctc
atgcaatatccccaggcaaaggccgttggtattggtttcccaggctttattgatccggtg
cacggtaccgtagcgcagtcgcccaacctgcctggcttgcgcaatgtggacctggctggt
gatctgtcggccgccattggtctgccagtcgtggtggaaaacgatgccctggctgcggcc
tatggcgaatatgtactgtgtgatcccaagccacacagtcttctttatgccgggctcggt
actggtgtgggtggcggcatgatctatgctggccgcccatttaccggcgagcacggagtt
gccatggaaatcggtcatttgattgtggagcctggtggacggtcatgcggctgcggcaat
catggctgcatggagcaatatgcatcagccagtggcatagcgcagagctaccacatggcg
accggtcagcgcgtggaggtcaatgccattgcccaggccgcgcgcgaaggcggtcaggcg
gcggtggaggctttttcccttgccggtgccgcactggcacaagcgctggcgcatgtcgtc
aagagcgtagacgtcgggcttatcgtgattggtggtggcgttagtcaggcctgggacttg
atggcgcctgccttttttacccgactggagcgcgacatgattccggtgctccgcgacaga
ctgcgcgtccagccttccgccagtggcgatcgcgctggcattatcggagcggctgcgctg
gctgagatcattctcgcgtcatcttcctga

DBGET integrated database retrieval system