KEGG   Methylovorus sp. MP688: MPQ_1349Help
Entry
MPQ_1349          CDS       T01361                                 

Gene name
nagC
Definition
rok family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mep  Methylovorus sp. MP688
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mep00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MPQ_1349 (nagC)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MPQ_1349 (nagC)
   00052 Galactose metabolism
    MPQ_1349 (nagC)
   00500 Starch and sucrose metabolism
    MPQ_1349 (nagC)
   00520 Amino sugar and nucleotide sugar metabolism
    MPQ_1349 (nagC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MPQ_1349 (nagC)
   00524 Butirosin and neomycin biosynthesis
    MPQ_1349 (nagC)
Enzymes [BR:mep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MPQ_1349 (nagC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1382174..1383103
Genome map
AA seq 309 aa AA seqDB search
MFLGVDIGGTNLRVGVVQHHALIHEQRALADFSGLCARHPPDEAWRQIIATTAATLRQCL
MQYPQAKAVGIGFPGFIDPVHGTVAQSPNLPGLRNVDLAGDLSAAIGLPVVVENDALAAA
YGEYVLCDPKPHSLLYAGLGTGVGGGMIYAGRPFTGEHGVAMEIGHLIVEPGGRSCGCGN
HGCMEQYASASGIAQSYHMATGQRVEVNAIAQAAREGGQAAVEAFSLAGAALAQALAHVV
KSVDVGLIVIGGGVSQAWDLMAPAFFTRLERDMIPVLRDRLRVQPSASGDRAGIIGAAAL
AEIILASSS
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
ttgtttttaggcgttgatataggcggcaccaatctacgagtgggcgtggtgcagcaccac
gcattgattcatgagcagcgcgcactggctgacttttctggtctgtgtgcccggcacccc
ccggacgaggcatggcggcagattattgcgactacggcggctaccttgcgccagtgcctc
atgcaatatccccaggcaaaggccgttggtattggtttcccaggctttattgatccggtg
cacggtaccgtagcgcagtcgcccaacctgcctggcttgcgcaatgtggacctggctggt
gatctgtcggccgccattggtctgccagtcgtggtggaaaacgatgccctggctgcggcc
tatggcgaatatgtactgtgtgatcccaagccacacagtcttctttatgccgggctcggt
actggtgtgggtggcggcatgatctatgctggccgcccatttaccggcgagcacggagtt
gccatggaaatcggtcatttgattgtggagcctggtggacggtcatgcggctgcggcaat
catggctgcatggagcaatatgcatcagccagtggcatagcgcagagctaccacatggcg
accggtcagcgcgtggaggtcaatgccattgcccaggccgcgcgcgaaggcggtcaggcg
gcggtggaggctttttcccttgccggtgccgcactggcacaagcgctggcgcatgtcgtc
aagagcgtagacgtcgggcttatcgtgattggtggtggcgttagtcaggcctgggacttg
atggcgcctgccttttttacccgactggagcgcgacatgattccggtgctccgcgacaga
ctgcgcgtccagccttccgccagtggcgatcgcgctggcattatcggagcggctgcgctg
gctgagatcattctcgcgtcatcttcctga

DBGET integrated database retrieval system