KEGG   Methylovorus sp. MP688: MPQ_1478Help
Entry
MPQ_1478          CDS       T01361                                 

Gene name
dxr
Definition
1-deoxy-d-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
mep  Methylovorus sp. MP688
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:mep00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1514571..1515764)
Genome map
AA seq 397 aa AA seqDB search
MLQSSPQNITILGATGTIGLNTLDVIARHPDKYRAYALTANGRAEALFDLCKQYHPRYAV
LLQEAAADRLRQMLIQAGIETEVLFGMDALEQVASAPEVDAVMAAIVGAAGLRPAMAAAH
AGKRIMLANKETLVMAGSLFMQAVEESGATLLPIDSEHNAIFQVMPAKKYPDLHSGGVRK
ILLTASGGPFRNASREQLLQVTSQQALNHPNWVMGPKITIDSATLMNKGLEVIEAKWLFD
ATPEQIEVVVHPQSVIHSMVEYVDGSVLAQLGNPDMRTPIAYALAYPERIDSGVGSLDLF
KIATLNFERPDTGRFPCLRLAFDVLKRGGTAPAILNAANEVAVEAFLQSRIGFMDIPALI
ERVLSLSSIEPVTDIPNLIAADQAARQLAQEWMVQSA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
ttgttacagtcatcaccacaaaacattaccatccttggtgccactggcaccatcgggctc
aatacgctggatgtgattgcccgtcaccctgacaaataccgcgcttatgcattaacggct
aacggtcgcgccgaggccttgtttgatctatgcaagcaatatcatccgcgatatgccgtg
ctgttgcaggaggccgcggcagatcgcctgcggcagatgctcatccaggcgggtattgaa
acggaagttctgtttggcatggatgccctggagcaagtcgcttccgctcctgaggtggat
gctgtcatggccgccattgtgggggcagccggtctcaggcctgccatggccgctgcccat
gccggcaagcgcatcatgctggccaacaaggaaacgcttgtgatggccggcagcttgttc
atgcaggcggtggaagagagtggtgcgaccttgctgcctatcgatagcgagcataacgcc
atctttcaggtcatgcctgccaaaaaataccctgaccttcacagtggcggtgtacgcaaa
atattgctgacggcatccggcggtccattccgcaatgccagccgggagcaattgctgcaa
gtgacttcgcagcaggcgctcaatcatcccaattgggtcatgggacccaagatcaccatt
gactctgccaccttgatgaacaaaggtttggaagtgattgaagcgaaatggctttttgat
gcaacgcccgagcagattgaggtggtggtgcatccacaaagcgtcattcattccatggtg
gaatatgtggatggctcggtgctggcgcaattggggaaccccgacatgcgtacgcccatc
gcttatgccctggcttatcctgagcgcatagacagcggcgtgggctcgctcgacttgttc
aagattgcgacattgaatttcgaacgtcctgacactggccgtttcccatgtttgcgcctg
gcttttgatgtgctgaagcgcggtggaacagcacctgcgattctcaatgcagctaatgaa
gtcgctgttgaggcgtttctgcaatctcgcatagggttcatggatatccccgccctcatc
gagcgcgtgctctcgctatccagcatagaacccgttactgacattcccaacctgattgca
gctgaccaggccgcccgtcagctggctcaggaatggatggtgcaatcagcatga

DBGET integrated database retrieval system