KEGG   Methylovorus sp. MP688: MPQ_1610Help
Entry
MPQ_1610          CDS       T01361                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mep  Methylovorus sp. MP688
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mep00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MPQ_1610 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MPQ_1610 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MPQ_1610 (trpA)
Enzymes [BR:mep01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MPQ_1610 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1654109..1654909)
Genome map
AA seq 266 aa AA seqDB search
MSRIKTTFDQLKQQGKKALIPYITAGDPHPDQTVKLLHAMVANGADMIELGVPFSDPMAD
GPVIQRASERALVHHVGLSRVLDIVREFRQQDNVTPIILMGYANPVEAMGQEKFSDRAKA
AGVDGVLTVDYPPEECKEFTALLQARGIDPIFLLSPTTEPARVEVIVNQASGFVYYVSLK
GVTGAKNLDIEEVAQKVAEIRTLTDLPVGVGFGVRDAATATAVAAIGDAVVVGSRMVQAV
EQSNDQNLVDNVAALMKELRIAVDAA
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgcataaaaaccacgttcgatcagctcaagcagcagggaaagaaagcactgatc
ccttacattaccgctggtgaccctcatcctgaccaaaccgtaaagctgttacatgccatg
gtggcaaacggtgccgatatgattgagctcggcgtgcctttttcagatccgatggcagat
ggtcctgttattcagcgcgccagcgagcgtgcgctggtccatcacgttggcctcagccgc
gtactcgacatcgtgcgtgagttccgtcagcaggataatgtgacgcctatcatactgatg
ggttacgctaatccggttgaagcaatggggcaggagaagttttctgatcgagccaaagcc
gccggtgtggatggtgtactgacggtggattatccgcctgaagagtgcaaggaattcacc
gccctgttgcaggcacgcggtattgaccccatttttctgttatcaccgaccaccgagcct
gctcgtgtggaggtgattgtgaaccaggccagcggcttcgtttactatgtctccctcaag
ggggtgacgggtgccaaaaacctcgatattgaagaggtggcgcaaaaagtggctgaaatt
cgaaccctgacggatttgcctgtaggcgtgggttttggtgtgcgtgatgcggcgacagca
acggctgtggctgcgattggtgatgctgtggtggtgggcagccgtatggtgcaggctgtg
gaacaatccaatgatcaaaatctcgttgataacgtggctgcgctgatgaaagaattgcgc
atcgcggttgacgctgcttaa

DBGET integrated database retrieval system