KEGG   Methylovorus sp. MP688: MPQ_1610Help
Entry
MPQ_1610          CDS       T01361                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mep  Methylovorus sp. MP688
Pathway
mep00260  Glycine, serine and threonine metabolism
mep00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mep01100  Metabolic pathways
mep01110  Biosynthesis of secondary metabolites
mep01130  Biosynthesis of antibiotics
mep01230  Biosynthesis of amino acids
Module
mep_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mep00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MPQ_1610 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MPQ_1610 (trpA)
Enzymes [BR:mep01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MPQ_1610 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA Peripla_BP_6 PcrB His_biosynth
Motif
Other DBs
NCBI-ProteinID: ADQ84765
Position
complement(1654109..1654909)
Genome map
AA seq 266 aa AA seqDB search
MSRIKTTFDQLKQQGKKALIPYITAGDPHPDQTVKLLHAMVANGADMIELGVPFSDPMAD
GPVIQRASERALVHHVGLSRVLDIVREFRQQDNVTPIILMGYANPVEAMGQEKFSDRAKA
AGVDGVLTVDYPPEECKEFTALLQARGIDPIFLLSPTTEPARVEVIVNQASGFVYYVSLK
GVTGAKNLDIEEVAQKVAEIRTLTDLPVGVGFGVRDAATATAVAAIGDAVVVGSRMVQAV
EQSNDQNLVDNVAALMKELRIAVDAA
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgcataaaaaccacgttcgatcagctcaagcagcagggaaagaaagcactgatc
ccttacattaccgctggtgaccctcatcctgaccaaaccgtaaagctgttacatgccatg
gtggcaaacggtgccgatatgattgagctcggcgtgcctttttcagatccgatggcagat
ggtcctgttattcagcgcgccagcgagcgtgcgctggtccatcacgttggcctcagccgc
gtactcgacatcgtgcgtgagttccgtcagcaggataatgtgacgcctatcatactgatg
ggttacgctaatccggttgaagcaatggggcaggagaagttttctgatcgagccaaagcc
gccggtgtggatggtgtactgacggtggattatccgcctgaagagtgcaaggaattcacc
gccctgttgcaggcacgcggtattgaccccatttttctgttatcaccgaccaccgagcct
gctcgtgtggaggtgattgtgaaccaggccagcggcttcgtttactatgtctccctcaag
ggggtgacgggtgccaaaaacctcgatattgaagaggtggcgcaaaaagtggctgaaatt
cgaaccctgacggatttgcctgtaggcgtgggttttggtgtgcgtgatgcggcgacagca
acggctgtggctgcgattggtgatgctgtggtggtgggcagccgtatggtgcaggctgtg
gaacaatccaatgatcaaaatctcgttgataacgtggctgcgctgatgaaagaattgcgc
atcgcggttgacgctgcttaa

DBGET integrated database retrieval system