KEGG   Methylovorus sp. MP688: MPQ_1611Help
Entry
MPQ_1611          CDS       T01361                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mep  Methylovorus sp. MP688
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mep00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MPQ_1611 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MPQ_1611 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MPQ_1611 (trpB)
Enzymes [BR:mep01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MPQ_1611 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1654935..1656137)
Genome map
AA seq 400 aa AA seqDB search
MQLYDMPDDRGHFGPYGGIFVAETLVEALEELRVMYERFRHDPEFLAEFAHDLKYFVGRP
SPIYYAKRWSERVGGARIYLKREDLNHTGAHKVNNTVGQALLAKRMGKPRVIAETGAGQH
GVATATIAARMGLECVVYMGSEDVKRQAPNVYRMKLLGATVVPVESGSKTLKDALNEAMR
DWVTNISNTFYIIGTVAGPHPYPMMVRDFQAVIGVEAKQQMQEMIGRQPDAVVACVGGGS
NAMGIFYPYINEENVRLIGVEAAGLGLATGKHAAPLTANSSVGVLHGNRTYLMQDEDGQI
IETHSISAGLDYPGVGPEHAWLKDSKRAEYVAITDDEAMAAFHSLCRTEGIIPALESSHA
LAYAEKMAATMSPDQVILVNLSGRGDKDINTVAGLSGITL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgcagctttatgatatgcctgacgacagaggccattttggtccgtacggcgggattttt
gtcgcagaaactctggtggaagccctggaagaattgcgtgtcatgtatgagcgctttcgc
catgaccctgaatttctggccgaatttgcacatgatctgaagtattttgtaggccgtcca
agccctatctactatgccaagcgctggtctgaacgcgttggcggtgctcgcatttatctc
aagcgggaagatctgaaccacactggcgcccataaggtgaacaacaccgtggggcaagca
ctactggcaaaacgcatgggcaagccacgcgtaatcgctgaaacgggggcaggccagcat
ggcgttgcgacggctaccattgcagctcgtatggggctggagtgtgtcgtgtacatgggg
tctgaagatgtgaagcgccaagctcccaatgtctatcgcatgaagctgttgggggcgacg
gttgtgccagtggaaagtggttcaaaaaccctcaaggatgcgctgaatgaagccatgcgc
gactgggtaaccaacatctccaacactttttacattattggtaccgtggctggcccgcac
ccttatcccatgatggtacgggattttcaggcggtgatcggtgtggaagccaagcagcaa
atgcaggaaatgatcgggcgtcagccagatgcggtcgtggcatgtgtgggcggcggttcc
aatgccatgggtattttctacccctacatcaatgaagaaaacgtgcgcctgatcggcgtt
gaggcagcgggcctgggcctagcaacgggcaaacatgccgcgccattgacagccaatagc
tcagtcggcgtattgcatggaaaccgtacttatctgatgcaggacgaagacggtcaaatc
atcgaaacgcattcgatctcggctggcctggattatccaggagtagggcctgagcatgca
tggctgaaagacagcaagcgtgctgaatacgtggccattaccgatgatgaagccatggcg
gctttccatagtctttgccgcaccgaaggtattattcctgcactggaatccagccatgcg
ttggcgtatgcagaaaagatggcggcgaccatgtctcctgaccaggtcattctggtgaac
ctctccggtcgtggcgataaagatatcaacacggtggccggtttgtctggcattaccctt
taa

DBGET integrated database retrieval system