KEGG   Methylovorus sp. MP688: MPQ_1644Help
Entry
MPQ_1644          CDS       T01361                                 

Gene name
acs
Definition
acetate/CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mep  Methylovorus sp. MP688
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:mep01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mep00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mep00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:mep00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:mep00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1686944..1688905
Genome map
AA seq 653 aa AA seqDB search
MSSIETVLTETRVFPPQEAFKQAATISGLEQYTALCQQAEQDYPGFWAALAQKELDWHKP
FTAVLDEANAPFYRWFHDGELNASYNCLDRHLSTRGDKAALIFEADDGTVTTVTYRQLHQ
RVCRFANALKKQGVGKGDRVIIYLPMSVEAIVAMQACARIGAIHSVVFGGFSSKSLHERI
TDVGAKLVITSDGQMRGGRAMPLKPAVDEALSFGGCEAVTSVIVYKRTGGDVTWNTRDLW
WHDLESAESDYCEPTWVNAEHPLFILYTSGSTGKPKGVQHSTGGYLLGAVMSMKWVFDHK
ATDIFWCTADVGWITGHSYVAYGPLALGSTQVVFEGVPTYPDAGRFWQMIEKHKVSVFYT
APTAIRSLIKLGGDLPNNYDLSSLRLLGTVGEPINPEAWMWYHKTVGRERCPIVDTWWQT
ETGAHMIAPLPGAINAKPGSCTRPLPGIMMDIVNEDGSHIDGTGGGLLVVKKPWPSMIRT
IWNDPERFKKSYFPEELKGVYLAGDSAHRDDDGYFWIMGRIDDVLNVSGHRLGTMEIESA
LVAHPLVAEAAVVGKPHEIKGESIVAYVVLKGARPEGDEAKQVVAQLRDWVGKEIGPIAK
PDEIRFGDNLPKTRSGKIMRRLLRSLAKGEEITSDISTLDNPAILEQLKQAVS
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcgattgaaaccgttctgaccgaaacccgcgttttccccccacaggaggccttc
aagcaggcagccaccatttcaggtctggaacaatacaccgcgctttgccagcaggccgag
caggattaccccggcttctgggctgcgctcgcgcaaaaggagctggattggcacaagcca
ttcaccgccgtgctggatgaagccaatgcgcctttctaccgctggtttcacgatggcgaa
ctgaatgcctcctacaactgcctggaccgtcatctttccacccgcggtgacaaagctgca
ctgattttcgaagccgacgacggcacggtcaccaccgtcacctatcgccagttacaccag
cgcgtttgccgctttgccaatgccctgaaaaaacaaggggtaggcaaaggtgatcgcgtg
atcatctatctgcctatgagcgtggaagccattgtcgccatgcaggcctgtgcccgtatc
ggcgccattcactccgtggtgtttggcggcttctcatccaagagcctgcacgagcgcatt
accgatgtcggtgccaagctggtgatcacctccgatggccagatgcgtggcggccgcgcc
atgccgctgaaaccggccgtggacgaagccttgagctttggcggttgcgaagccgtgacc
agcgtgattgtgtacaagcgcaccggcggcgatgtcacctggaatacgcgtgacttgtgg
tggcatgatctggaaagcgcagaatccgattactgcgagccaacctgggtcaatgccgag
catccgctattcattctctatacctcaggctccaccggcaaacccaagggcgtgcagcat
tccactggcggctatctgctgggtgcggtcatgagcatgaaatgggtattcgaccataaa
gccacggatattttctggtgcacggccgatgtgggctggattaccggccatagctatgtc
gcctatggcccgctggcgctgggcagcacgcaagtcgtgtttgaaggcgtgccgacttac
cccgatgctggtcgcttctggcagatgatcgaaaagcacaaggtcagcgtgttttacacc
gcgcccacggcgattcgttcgctgatcaagctgggcggcgatttaccgaataattacgat
ctttccagcctgcgcctgttgggcacagtgggcgagcccatcaaccctgaggcctggatg
tggtatcacaaaaccgtgggccgcgagcgctgcccgattgtggatacctggtggcaaacc
gaaaccggcgcgcacatgattgccccgctgcccggtgccatcaatgccaagcccggctcc
tgcacccgtcccctgcctggcatcatgatggatatcgtcaatgaagatggcagccatatt
gatggcactggcggtggtctgctggtagtgaagaagccatggccatccatgatacgcacc
atctggaatgacccggagcgcttcaagaaatcctatttccccgaagaactgaaaggcgtt
tacctcgccggtgactcagcccaccgtgacgatgatggctatttctggatcatgggccgc
attgacgatgtgctgaatgtttccggtcaccgcctcggcaccatggaaattgaatccgcg
ctggtagcccatccgctggtggcggaggctgccgtggtcggcaagccgcatgagatcaag
ggcgaatccatcgtcgcttatgtagtgctgaaaggcgcccgtccggaaggcgatgaggcc
aagcaggtcgtggcgcagctgcgtgactgggtcggcaaggaaatcggccccatcgccaag
cccgatgaaatccgctttggcgataacctgcccaagacccgctccggcaagatcatgcgc
cgcctgctgcgctcgctggccaagggcgaggaaatcacctccgatatttccacgctggat
aatccggccattctggaacagctgaagcaggctgtttcctga

DBGET integrated database retrieval system