KEGG   Methylovorus sp. MP688: MPQ_1669Help
Entry
MPQ_1669          CDS       T01361                                 

Gene name
btuE
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
mep  Methylovorus sp. MP688
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:mep00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:mep00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1714700..1715278)
Genome map
AA seq 192 aa AA seqDB search
MVQSGLRRLHESSERKMKYLVAVLLWVASNMAYAGGCNELYNHQFNTLQGEKINLCDYQD
KPILVVNTASKCGFTPQFEKLESMYKHYKSRGLLIIGFPSNDFKQELSSNKEIGDFCKQT
YAVQFPMVGKTSVVGPQAHLFYKQLAAITKEPPMWNFYKYLILPNGEQVYAYSSDVEPEA
SQIMTKLKPYLK
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
gtggtgcaaagcggtttgcgcaggcttcatgaatccagtgagagaaaaatgaaatatcta
gtggcagttttattgtgggtggcgagcaatatggcatatgcaggagggtgtaacgagctt
tacaaccatcaattcaataccttgcagggcgagaagatcaacctttgcgactatcaggat
aagcctattctggtggtcaacaccgccagcaaatgcggtttcacgccgcagtttgaaaag
ctggagtccatgtacaagcattacaaatcgcgtggtttgctgatcattggctttccttcc
aatgacttcaagcaggagttgagcagcaacaaggagataggtgacttttgcaagcagacc
tatgccgtgcaattccccatggtaggcaagacttctgtggtggggccgcaagcgcatctt
ttctacaaacagttggcggcgatcaccaaagagccccctatgtggaatttttacaaatac
ctgatcttgcccaatggcgagcaggtgtatgcctacagcagtgatgttgagcctgaggcc
agccagatcatgaccaagctgaagccttatctgaaataa

DBGET integrated database retrieval system