KEGG   Methylovorus sp. MP688: MPQ_1676Help
Entry
MPQ_1676          CDS       T01361                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
mep  Methylovorus sp. MP688
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mep03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1719484..1720083
Genome map
AA seq 199 aa AA seqDB search
MRNPPALEQLVESLRCLPGVGPKSALRMAYHLLQRDRSGANGLAQALHNALQVVTHCSLC
NTFSEDIVCPLCAADNRDPTLLCVVEMPTDLMMLEQTRVFQGRYFVLMGKLSPLDGIGPK
EIHLEKLLKRAQDGVVEEVVLATNYTVEGEATAHYISELLRSRGLKVSRIARGLPMGGEI
EHVDSGTLAQALMERRSVR
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaatccgcccgccctggagcagcttgttgagtccctgcgctgccttccaggcgta
ggccccaagtccgcattgcgcatggcctatcaccttttgcagcgtgatcgcagcggcgcc
aatggcctcgcccaggcgctgcacaatgcattgcaagtcgtcacccattgcagcttgtgc
aacaccttcagcgaagatatcgtctgccctctatgcgcagcggataaccgcgaccccact
ttgctctgcgtggttgaaatgcccacggacctgatgatgctggagcagacgcgcgtgttt
cagggccgctactttgtattgatgggcaagctatccccgctcgatggcataggccccaaa
gaaattcatctggaaaaactgctgaaacgtgcgcaggatggcgtggtagaagaagtggtg
ctcgccaccaattacaccgtggaaggcgaagctacggcgcactacatcagcgagctactg
cgctcacgtggcctcaaggtgagccgcatcgcacgtggcttgcctatgggcggcgaaatt
gagcatgtggatagcggcacactggcgcaggccctgatggagcgccgcagcgttcgctaa

DBGET integrated database retrieval system