KEGG   Methylovorus sp. MP688: MPQ_1747Help
Entry
MPQ_1747          CDS       T01361                                 

Gene name
tesA
Definition
arylesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
mep  Methylovorus sp. MP688
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:mep00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    MPQ_1747 (tesA)
Enzymes [BR:mep01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     MPQ_1747 (tesA)
   3.1.2  Thioester hydrolases
    3.1.2.-  
     MPQ_1747 (tesA)
Lipid biosynthesis proteins [BR:mep01004]
 Fatty acid synthase
  Component type
   MPQ_1747 (tesA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1798782..1799423
Genome map
AA seq 213 aa AA seqDB search
MIFRLLIITFFSCCTALTAMAAAPSSNTAPVILVFGDSLSAGYGIPRESGWVSLLQQRLQ
QRGLPHRVVNASISGETTSGGLSRIAEAVRTHQPSLVLVELGANDGLRGLPVEQMQQNLN
KIIATNEAAKARTILIGMMIPPNYGPRYTQSFNGSFRELAEAHKLPLVPFLLEGVAGNAS
LNQDDGLHPRAEAQERLLDNVWKVLAPALKIAP
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgattttccgtttactgatcattacgtttttttcgtgttgcaccgcgctcaccgccatg
gcggccgcgccatccagcaatactgcacccgtcattctggtgttcggcgacagcctgtcg
gctggctatggtattccgcgtgaatcgggctgggtcagcctgctgcagcaacgcctgcaa
caacgcgggctgccgcatcgtgtcgtcaacgccagcatcagcggcgaaaccaccagcggt
ggcctgagccgcatcgccgaggccgtgcgtacgcaccagccctcgctggtgctggtggag
ctgggggcgaatgacggcctgcgtggccttcccgttgagcagatgcagcaaaacctcaac
aagatcatcgccaccaacgaggctgccaaggccaggaccatcctgatcggcatgatgatt
ccccccaactatggccctcgttatacgcaatcgttcaatggcagcttccgcgagttggca
gaagcgcacaaattgccgctggtgccctttctgctggaaggcgtggcaggcaatgccagc
ctgaatcaggacgatgggctgcacccacgtgccgaagctcaggagcgattgctggataac
gtatggaaggtgctggcacctgcactgaaaatcgcgccttaa

DBGET integrated database retrieval system