KEGG   Methylovorus sp. MP688: MPQ_1824Help
Entry
MPQ_1824          CDS       T01361                                 

Gene name
galU
Definition
utp-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mep  Methylovorus sp. MP688
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mep00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MPQ_1824 (galU)
   00052 Galactose metabolism
    MPQ_1824 (galU)
   00500 Starch and sucrose metabolism
    MPQ_1824 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    MPQ_1824 (galU)
Enzymes [BR:mep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MPQ_1824 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1881251..1882150)
Genome map
AA seq 299 aa AA seqDB search
MRQKNVTKAVFPVAGLGTRFLPATKANPKEMLPVVDKPLIQYAVEEAVAAGITDLIFITG
RNKRSISDHFDMAYELENELERNGKKQLLSVVQNIVPKNVNCIYIRQNQALGLGHAVKLA
KPVVNDDPFAVILADDLIDAKVPVVKQMVDAYQYYRCSLLGVQEVPRDQTKSYGIVATHP
MSNGIEQVAGIVEKPKPEEAPSNLGVVGRYILTPRIFHHLENLQAGSGGELQLTDAIASL
LSEEQILAYRFEGTRYDCGSKSGFLEATVRLGLKHPECGKDLRALLEAIAAEGLVGKKK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcaaaaaaatgtcactaaggcagtcttcccggtcgcgggcctgggtacgcgtttt
ctgccggctacaaaagccaatcccaaggaaatgttgcctgtcgtcgacaagccattgatt
caatacgcggttgaagaagcggttgctgctggcatcaccgatcttattttcattactggc
cgtaacaagcgctccatctctgaccatttcgatatggcctacgagctggaaaacgagctg
gaacgcaatggcaagaagcaattgctgtctgtggtgcagaatattgttcccaagaatgtg
aactgcatctacatccgccaaaaccaggcgctgggcctgggccatgcggtcaagctggca
aagcctgtggtgaatgatgatccatttgccgtgattctggcggatgacttgattgatgcc
aaagtgcctgtggtcaaacaaatggtagatgcctaccagtattaccgttgctcactgctc
ggcgtgcaggaagtgccgcgcgatcagaccaagagctacgggattgtggcaacccacccg
atgagcaatggcattgagcaagtggctggtatcgtggaaaagcctaagccagaagaagcg
ccttccaacctgggtgtggtcggccgttatatcctgacgccccgtattttccatcatctg
gaaaacctgcaagccggttccggtggcgagctgcaattgaccgatgcgatcgccagcttg
ctgagcgaagaacagattctggcataccgctttgaaggtacgcgttacgattgcggctcc
aagtccggtttcctggaagctaccgtgcgtctgggtctgaagcaccctgagtgcggcaag
gatctgcgtgccttgttggaagccatcgccgctgaaggcctggttggcaagaagaagtaa

DBGET integrated database retrieval system