KEGG   Methylovorus sp. MP688: MPQ_1988Help
Entry
MPQ_1988          CDS       T01361                                 

Definition
cytochrome c precursor protein
Orthology
K08738  
cytochrome c
Organism
mep  Methylovorus sp. MP688
Pathway
Sulfur metabolism
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:mep00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:mep02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2057104..2057400)
Genome map
AA seq 98 aa AA seqDB search
MGMQVFNEECAECHSVKEGKNKKGPSLWNILGRKSATVPDFNYSDAMKASGIVWTEDRIA
AYMEHPKKIVPGGIMKYEGLDDPKARKALLEYLSTLHG
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgggcatgcaggtattcaacgaggagtgcgctgaatgccatagcgtgaaagaaggtaaa
aacaagaaagggccttctctgtggaatattctcgggcgcaagtccgccaccgttcctgat
ttcaactattccgatgccatgaaagccagtggcatcgtctggactgaggataggatagcg
gcctatatggaacatcccaagaaaattgttcccggcggcatcatgaagtacgaaggactg
gatgatcccaaagcccggaaagccctgctggaatatctgtccaccttgcatggctaa

DBGET integrated database retrieval system