KEGG   Methylovorus sp. MP688: MPQ_1988Help
Entry
MPQ_1988          CDS       T01361                                 

Definition
cytochrome c precursor protein
Orthology
K08738  
cytochrome c
Organism
mep  Methylovorus sp. MP688
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:mep00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    MPQ_1988
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MPQ_1988
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2057104..2057400)
Genome map
AA seq 98 aa AA seqDB search
MGMQVFNEECAECHSVKEGKNKKGPSLWNILGRKSATVPDFNYSDAMKASGIVWTEDRIA
AYMEHPKKIVPGGIMKYEGLDDPKARKALLEYLSTLHG
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgggcatgcaggtattcaacgaggagtgcgctgaatgccatagcgtgaaagaaggtaaa
aacaagaaagggccttctctgtggaatattctcgggcgcaagtccgccaccgttcctgat
ttcaactattccgatgccatgaaagccagtggcatcgtctggactgaggataggatagcg
gcctatatggaacatcccaagaaaattgttcccggcggcatcatgaagtacgaaggactg
gatgatcccaaagcccggaaagccctgctggaatatctgtccaccttgcatggctaa

DBGET integrated database retrieval system