KEGG   Methylovorus sp. MP688: MPQ_2007Help
Entry
MPQ_2007          CDS       T01361                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mep  Methylovorus sp. MP688
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mep00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    MPQ_2007
Enzymes [BR:mep01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     MPQ_2007
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2075981..2076706
Genome map
AA seq 241 aa AA seqDB search
MITAICDVLKECYSRGWISTRDGNGSVRRKNENWIYVTPSGSKKHRLEAESLIKLEFQPD
HSLIRLNPEDGGKPSGEIELHRRLLKEIPDTRAIIHVHPTYTIAAMYAGLDLQALSLDFP
EIHRYTRVAPNVPNVPAISLELAMATCQALDLQPDGHVSADIVGLDRHGVIALARDPWGA
FEHIERLEHICQIVLASGNLPKHHIATDLQAHEPATHAHADVEKTEQEETLNPGLNSSND
I
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgattactgccatatgtgatgtattgaaggaatgttatagccgcggatggatatcgaca
cgggatggtaatggatctgttcgccgcaaaaacgagaactggatatacgtcacgccgtcg
ggttccaaaaagcacaggctggaagccgaaagcctgatcaagcttgagtttcagcctgac
cactcgctgatacgacttaaccctgaggatggcggcaaacccagcggcgaaatcgagctg
cacagaaggttgctgaaagagattccggacacccgcgccattatccacgtgcatcccacc
tataccatcgccgccatgtatgccggactggacttgcaggcattgtcactggattttccc
gaaatccatcgttacacgcgcgtggcgcccaatgtgccgaacgtaccggcgatcagcctg
gaattggcgatggccacctgccaggcactcgacttgcagccggatgggcatgtctcggcg
gatattgtgggcttggaccgtcatggggtgattgccttggcgcgcgatccctggggagct
tttgaacatattgagcgactggagcatatctgccagattgtgctggccagtggcaatctg
cccaaacatcacatcgccacagacttgcaagcccatgagccagccacgcacgcgcatgcc
gatgttgaaaaaaccgagcaagaagaaaccctgaatccgggcttgaacagcagcaatgat
atttga

DBGET integrated database retrieval system