KEGG   Methylovorus sp. MP688: MPQ_2026Help
Entry
MPQ_2026          CDS       T01361                                 

Gene name
nei
Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mep  Methylovorus sp. MP688
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mep03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2094285..2095073)
Genome map
AA seq 262 aa AA seqDB search
MQGLAPLVGQPVAKVIIRHPTLRWPIPADLVHTLPQQTLKSLTRRAKYILAQFDTGYLLL
HLGMSGRICLLAQDEPAAKHDHFDLHFADGQVLRLRDPRRFGAVLWAGADPAQHALLNVL
GPEPLESAFDGDWLYRQFRTRSAPVKNAIMDSHLVVGVGNIYASESLFRARIHPQTPANQ
LSRQACDRLAAEIKATLTDALAAGGSSLRDFFGADGNPGYFQQEYFTYARTGEACKICST
PIQNVRLGQRSTFFCPRCQPKP
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgcagggcctggccccgctggtcggccagccggtagccaaggttatcatccgtcatccc
accctgcgttggcccatcccggccgatctggtgcatacccttccgcagcagaccctgaaa
tcgctcacgcgtcgcgccaaatacattctggcgcaatttgataccggttatctcttgctg
catcttggcatgtcgggccgcatctgcctgctcgcgcaggatgagcctgccgccaagcat
gatcactttgacctgcattttgccgatgggcaggtgttgcgtttgcgggatccgcggcgt
tttggagcagtgttatgggcaggagcagaccctgcgcagcacgcgctcttaaatgtgctg
gggccggagccgctggaatccgcctttgatggcgactggctgtatcgccagtttcgcacg
cgcagcgccccggttaaaaatgccatcatggatagtcatctggtagtcggcgtgggcaat
atctacgccagtgaatcgctgtttcgcgcgcgcattcatccgcaaacgcctgccaaccaa
ctgagtcggcaggcatgtgaccgactggccgcggagatcaaggctaccctgaccgatgcg
ctggcagccggaggcagcagcctgcgtgatttctttggcgcagatggtaatccggggtat
tttcagcaggagtacttcacttacgcacgcacaggcgaggcctgcaagatatgcagcacg
cctatccagaacgtgcggctggggcagcgctcgactttcttctgcccgcgctgccagccc
aaaccctag

DBGET integrated database retrieval system