KEGG   Methylovorus sp. MP688: MPQ_2457Help
Entry
MPQ_2457          CDS       T01361                                 

Gene name
trpC
Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mep  Methylovorus sp. MP688
Pathway
mep00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mep01100  Metabolic pathways
mep01110  Biosynthesis of secondary metabolites
mep01130  Biosynthesis of antibiotics
mep01230  Biosynthesis of amino acids
Module
mep_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mep00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MPQ_2457 (trpC)
Enzymes [BR:mep01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     MPQ_2457 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS DUF4035 QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ADQ85599
Position
complement(2519987..2520775)
Genome map
AA seq 262 aa AA seqDB search
MSDILNKILRVKQAEVQAAMAAHPLVMVQRDAQAMPAPRDFVGAIRQKMNAGQAAVIAEI
KKASPSKGVIREDFQPAQIAASYEKGGAACLSVLTDRDFFQGSPEYLQQARAACALPVLR
KDFMIEAYQVYEARAMGADCILLIAAALDLPRMRQLETIAHDLDMAVLVEVHNGEELDLA
LQLETPLLGINNRNLRTFEVTLDTTLGLLPRIPAGKIVVTESGIFTPEDVALMRQHEVHT
FLVGEAFMRQPEPGAELARVFA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatatcttgaataaaatcctccgcgtgaagcaggcggaagtgcaggccgccatg
gccgcccatccgctcgtcatggtgcagcgcgacgcgcaggccatgccagcgccgcgtgac
tttgtgggcgctattcgccagaagatgaatgcaggccaggccgcggtgattgccgaaatc
aaaaaggccagcccctccaaaggggtaattcgcgaagacttccagcctgcccagattgcg
gcaagctatgaaaagggcggtgcagcctgtctttccgtgctgaccgatcgcgatttcttt
cagggctcgccagaatatttgcagcaggcgcgggccgcgtgtgccttacctgtgttgcgc
aaggatttcatgatcgaggcgtatcaggtgtacgaagcccgggccatgggcgctgattgc
atactgctgatcgccgccgccctggatctgccacgcatgcgccagctggaaaccattgcc
catgatctggacatggcggtgctggtggaagtgcataacggggaagagcttgatttggcg
ctgcagctggagacgcctttgctcgggatcaataaccgcaatctgcgcacgtttgaagtg
acgctggataccacgctgggattattgccgcgcattccggcgggcaaaatcgtcgtcacc
gaatccggtatttttacgccggaagatgtagccctgatgcgtcagcatgaggtgcatacc
ttcctggtgggcgaggcgttcatgcgccagcctgagccaggtgccgaactcgcccgtgta
tttgcctga

DBGET integrated database retrieval system