KEGG   Methylovorus sp. MP688: MPQ_2566Help
Entry
MPQ_2566          CDS       T01361                                 

Definition
protein-l-isoaspartate(d-aspartate) o-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mep  Methylovorus sp. MP688
Brite
Enzymes [BR:mep01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     MPQ_2566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2633781..2634443
Genome map
AA seq 220 aa AA seqDB search
MMHKDVEQARFNMIEQQIRTWEVLDARVLDLLSQVPREDFVPEQYRGLAFADLEIPIGAG
QQMLSPKMEGRIVQALEISKTDRVLEIGTGSGYLTALLATLAKEVVSLEIHADLSVAAQR
KLQQHGIHNVNLEIADGSQGWANGAPYDVIVFTGSLPLLPVIAEQQLAINGRLFAVVGEG
PAMEATMIRRVSADSFRHDVLFETSVPPLQNAPHPARFEF
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgatgcataaggatgtagaacaagcacgttttaacatgattgagcagcagatccgcaca
tgggaagtgctggacgcccgcgtactggacctgttaagtcaggtgccgcgcgaggatttt
gtgccggaacaatatcgtggtctggcgtttgctgatctggaaattcccatcggcgctggt
cagcaaatgctttcacccaagatggaaggccgcatcgtgcaggcgctggaaatcagcaaa
actgaccgcgtgctcgaaatcggcaccggcagtggctacctgaccgccctgctggcaaca
ctcgccaaggaagtggtcagcctggaaattcatgctgacctcagcgttgccgcccaacgc
aaactgcaacagcacggcatacacaatgtgaacctggaaattgccgatggcagccagggc
tgggccaatggcgcaccgtatgatgtcatcgtgttcaccggctcgctacctttgctgccc
gtgattgccgaacagcaacttgccatcaacggtcgcctgtttgccgtggtaggcgaaggc
cctgccatggaagccaccatgatacgtcgcgtcagcgccgacagtttccgtcacgatgtg
ctatttgaaacctcggtgcctcctctgcaaaacgcgcctcatccagctcgcttcgaattc
taa

DBGET integrated database retrieval system