KEGG   Methylovorus sp. MP688: MPQ_2641Help
Entry
MPQ_2641          CDS       T01361                                 

Definition
response regulator receiver modulated cheb methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
mep  Methylovorus sp. MP688
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:mep00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MPQ_2641
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    MPQ_2641
Enzymes [BR:mep01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     MPQ_2641
Two-component system [BR:mep02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   MPQ_2641
Bacterial motility proteins [BR:mep02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    MPQ_2641
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2719548..2720630)
Genome map
AA seq 360 aa AA seqDB search
MNKIKVMIVDDSAVVRQVLTSYLEASKEVEIIGAASDPIFAIEKMQKEWPDVIILDVEMP
RMDGITFLKKIMAQRPTPVIICSTLTEKGAETTMEALAAGAVSIITKPKAGLKSFMTESA
DDLVQHIKAAAKANVRKILHHDPQPVLKTPAKLTADAVLAPKPAAMAQTTEKIVAIGTST
GGTQALERVLTALPRVCPGIVIVQHMPENFTAAFAARLNQLCAIEVKEAAKGDRVVMGRA
LIAPGGKHMVLKRSGAQYFVDVIDGPPVSRHKPSVNVLFRSVAQSAGKNALGIIMTGMGD
DGAQGMKEMHEVGATTVAQDERSCVVYGMPKEAVKLGGVNKSISLDAIAAEIQNYGAMHR
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaataaaagtcatgatcgtggatgattcggccgtcgtgcggcaagtgctgacg
agctatcttgaagcttcaaaagaggtggagattatcggggcggcttccgaccccattttt
gccattgagaaaatgcagaaggaatggccggatgtgatcattctggatgtggaaatgccg
cgcatggatggcattaccttcctgaaaaaaatcatggcgcagcgccccacaccggtcatt
atctgttcgacgctgaccgaaaaaggagctgagactaccatggaagccctggcagcaggg
gcggtcagcattattaccaaacccaaggccggcttgaaatcctttatgaccgagtcggcg
gatgacctggtgcagcatatcaaggctgcggccaaggccaatgtgcgcaagattctgcat
catgaccctcagccagtgctgaaaacaccggccaaactgacggcggatgcggtgctggca
cccaagcccgctgccatggcgcagacgaccgaaaagattgtcgccattggcacctccacc
ggaggtacacaagcactggagcgtgtgctgacggcgctgccccgggtatgtccgggtatt
gtgattgtgcagcatatgccggaaaactttacggcggcgtttgccgcccgccttaaccag
ctctgtgccattgaagtaaaagaagcggccaaaggcgaccgcgtggtgatgggccgtgcg
ctgattgcgccgggcggcaagcatatggtgctaaagcgcagtggcgcgcagtattttgtc
gacgtaattgatgggccgcccgttagtcgtcataagccctcggtcaatgtgctgttccgt
tcggtggcgcagtctgccggtaaaaatgccctcggcatcatcatgaccggcatgggcgat
gatggcgcccagggcatgaaagagatgcatgaggtgggagcgacgaccgtggcccaggat
gagcgcagctgtgtggtgtatggcatgcccaaggaagccgtgaagctgggcggggtcaac
aagagcatctcgctggatgcgattgccgccgaaatccagaactatggagccatgcatcgt
taa

DBGET integrated database retrieval system