KEGG   Methylovorus sp. MP688: MPQ_2713Help
Entry
MPQ_2713          CDS       T01361                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
mep  Methylovorus sp. MP688
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2798554..2800422)
Genome map
AA seq 622 aa AA seqDB search
MQEKPTPIEIARQALMQLASRKVPPTPDNFRTVYDEIAGVVSTNETLELAHVLDKVLHDA
GKQRPKYIAAAQSIATLIEKKDWSRLEDQLIKLLPLGAAGGDETSWPVVIRNLLKQLEVS
HKGVTLTRKKEGLNRVLTNFGSDPDVLPQKIQSLVNSWGQGSVADHVPGDGPQVLEGEAE
TIGETPTPAPSKSLYGKKPAEYWREMLVRTMELVLIPQLHSLPEPEAKAKQLVKDINAAT
NETQIKRIAEELKSVLFTLEMHGDQQNRLHEALLQLLRLLNNSMGELVLEDKWLHGQTKI
VQDILEKPLDLTRLYDAESSLKELLYKQGQIKPRLIEAKDSLKRMAEIFVDRLAEMDTDT
GEYQNKLNGYRDRITSTEDLVELNSVIDSLLNDTRSIGLSIQRSKDALVDAQQRADEAEK
LIDELTRRLDHISEVAHEDYLTGTLNRRGMDEAMEREFARADRHGTPLSIAMMDIDHFKQ
LNDNLGHATGDQALIHLVRIVKYSLRNTDVLARYGGEEFIIILPSTKQDEAMDIMKRVQR
DLTKNFFMHRNERVLITFSAGVAERLPGEGPETIVPRADAALYKAKHSGRNQVIGAEALL
EEPEIREITDASAAEANGNNAA
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaaaaccgacccccatcgagattgccaggcaggcattgatgcagcttgcctcg
cgcaaagtcccgcctacgccggataatttccgcacggtttatgacgagattgccggcgtc
gtatccaccaatgaaaccctggaactggcccatgtgctggacaaggttctgcacgacgcg
ggcaagcaacgccccaagtacattgccgccgcccaatccatcgctacgctcatcgagaaa
aaagactggtccaggctggaagaccagctcatcaagctattgcccttgggcgcagcaggt
ggcgatgaaaccagctggcccgtggtcatccgcaacctgctgaagcagctggaagtcagc
cacaagggcgtcaccctgacgcgcaagaaggaaggccttaaccgggtgctgaccaacttc
ggcagtgatcccgatgtcttgccgcaaaagattcaatccctggtcaattcatggggccag
ggttcggtggccgatcatgtaccgggtgatgggccgcaggtgctggaaggcgaagcggaa
accataggcgaaacgcccacccctgctcccagcaagtcgctgtatggcaaaaagcccgcc
gaatattggcgtgagatgctggtgcgtaccatggagctggtgctgattccgcaactgcat
tccctgcccgagccggaagccaaggccaaacagctggtcaaggatatcaatgccgccacc
aatgaaacccagatcaagcgtattgccgaagaattgaagagcgtgctgtttaccctggag
atgcatggcgatcagcagaaccgtctgcatgaagccttgttgcagttattgcgactgctg
aacaacagcatgggtgagctggtgctggaggataaatggctgcatgggcagaccaaaatc
gtgcaggatatcctcgaaaaaccgctggatcttacccggctctatgacgccgaaagcagc
ttgaaagagttgctgtacaagcaggggcagatcaagccacgcctgattgaagccaaggac
tcgctgaagcggatggccgaaatctttgtggacagactggctgagatggacaccgatacc
ggtgagtaccagaacaagctgaatggctatcgcgaccgcattacgtcgaccgaagatctg
gtggaactcaactcggtgatcgacagcctgctcaacgatacccgcagcataggcctgagc
atacagcgttccaaggatgcgctggtggatgcgcagcaacgcgctgacgaggctgagaag
ctgattgatgagctgacgcgccgtctggaccatatcagcgaagtggcgcatgaagactac
ctcaccggcacactcaaccgccgcggcatggatgaagccatggagcgcgaatttgcacgg
gccgaccggcatggtacgccgctcagcatcgccatgatggatatcgaccacttcaagcag
ctcaacgataacctgggtcatgcgactggcgaccaggccttgatccatctggtgcgcatc
gttaaatactcgctgcgcaataccgatgtgctggcgcgctatggtggcgaggagttcatc
atcatactgcccagtaccaagcaggatgaggccatggacatcatgaagcgcgtacagcgg
gatctcaccaaaaacttcttcatgcatcgcaacgagcgtgtgctgatcacctttagcgcc
ggggtcgccgaacggctaccgggcgaggggccggaaaccatcgtcccgcgtgctgatgcc
gcgctctacaaggccaagcacagcggtcgcaatcaggtgattggcgcggaagccttgctg
gaagagcccgagatacgtgaaattaccgatgccagtgcggcagaggcaaacggtaacaat
gcggcttaa

DBGET integrated database retrieval system