KEGG   Methanomassiliicoccus sp. Mx1-Issoire: H729_06960Help
Entry
H729_06960        CDS       T02692                                 

Definition
PfkB domain protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mer  Methanomassiliicoccus sp. Mx1-Issoire
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mer00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    H729_06960
Enzymes [BR:mer01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     H729_06960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1482756..1483691)
Genome map
AA seq 311 aa AA seqDB search
MDLLGVGSVYYEIMYDLPKNSNISLEEIRMDSSKPDQLLEKLQNACPPLYHGIGGSSANT
IYALSRLGYRVGYLGVVGNDKYSKETLSFFKDVDSRLVRRYGESGISIRVFDEKETLHLK
FPNSNNYLSFIEDDLSIINSSNYIYLGPIEAGNPVNSYKQLLNFIDDSIYIFYAPGIECA
SLGLQKLGDLISKARIVFVTKTELELLTSSDLSDGCKAMIDEGARVVVCINDSDATIVSK
HSNYTLPFKKTVLKDNTDFLDAYIAGFLSAYVEGSDLNICGNAGATVAALTSTSYGRKSY
PDSKFLKNILP
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggatttgctcggtgtcggctcagtgtattatgaaatcatgtatgatcttcctaaaaat
tcaaacatatctttagaagaaattcgcatggattcctcgaagccagatcaactcctagaa
aaacttcaaaatgcttgtccgccgctgtatcacggaattggtggtagcagtgcgaacaca
atatacgcgctatcgcgtttggggtaccgtgtgggatatttgggagttgtgggcaacgac
aaatattcaaaagagaccttatccttttttaaagacgttgattctagattagtccgacgg
tatggagaatctggaatttctattcgcgtctttgatgaaaaagaaactctccatctgaaa
tttccaaattcaaacaattatctctcatttattgaagacgacctgtcaatcataaattca
tcgaattacatatatcttggtccaatcgaggctggaaatccagtcaactcctacaagcag
cttttaaatttcatagatgattcaatctatatattttatgcacctggaattgaatgcgca
tctcttggacttcagaagctcggagacctcatatctaaagctcgtattgtttttgtcaca
aaaactgaacttgaactcttaacttcatcagatctgagtgatggctgtaaagctatgatt
gatgaaggtgcaagggttgtagtatgcattaatgatagcgatgccactattgtttctaag
cattccaattacacattgcctttcaaaaagacagtcttaaaagataatacagatttcctg
gatgcatacatagcaggatttttatcggcgtatgttgagggatctgaccttaatatatgt
ggtaatgcaggcgcaaccgttgctgcattaaccagtacttcgtatggcaggaagtcatac
cctgattcgaagtttctaaaaaatattttaccatga

DBGET integrated database retrieval system