KEGG   Methanomassiliicoccus sp. Mx1-Issoire: H729_07705Help
Entry
H729_07705        CDS       T02692                                 

Definition
Ribulose-5-phosphate 4-epimerase-related epimerase/aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mer  Methanomassiliicoccus sp. Mx1-Issoire
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mer00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1649610..1650224)
Genome map
AA seq 204 aa AA seqDB search
MNEQLSQDLADVGRLLYEKRLTIASGGNMSVRAGNSMLITPSGVCKGMLSGRDMIEIDIS
SGEIIGKGKPSIETPFHLGIYRSRPDVNAVIHCHPVSCTVLAIQKKDLRTNLTPESLMIL
GKDVPMIPYDTPGSDGLAEKLIATMGPSKACLMQNHGALVVGKDLMDAFFRMETLEYIAT
LQLKCGEVPGLPEDEIERVLAMSK
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaacaactttctcaggatctggctgatgtcggcaggctgctttatgaaaagcgt
ctgacaattgccagcggcggcaatatgagtgtaagggctggcaactctatgttgatcact
ccgtcaggtgtctgcaaaggaatgctttccggtcgcgatatgattgaaattgatatttca
tcaggagagataatcggaaaaggaaaaccatcaatcgagactcccttccatttagggatc
taccgttcccggcctgatgtaaatgcagtcatccactgccatcctgtttcttgcacagtt
cttgccatccagaaaaaagatctccgtacgaatcttactccagaatctttaatgatccta
ggaaaagatgtgccgatgataccttacgatactccaggttcagacggcttggctgagaaa
ttaattgccactatgggaccaagcaaagcctgcctgatgcagaaccacggcgctttggta
gtcggcaaagatctgatggatgccttcttcagaatggaaacccttgaatacattgccact
ttacaattgaaatgcggtgaggtacccggtcttccagaagatgaaatcgaaagggtactt
gctatgagcaaatga

DBGET integrated database retrieval system