KEGG   Methanomassiliicoccus sp. Mx1-Issoire: H729_07705Help
Entry
H729_07705        CDS       T02692                                 

Definition
Ribulose-5-phosphate 4-epimerase-related epimerase/aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mer  Methanomassiliicoccus sp. Mx1-Issoire
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mer00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    H729_07705
Enzymes [BR:mer01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     H729_07705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1649610..1650224)
Genome map
AA seq 204 aa AA seqDB search
MNEQLSQDLADVGRLLYEKRLTIASGGNMSVRAGNSMLITPSGVCKGMLSGRDMIEIDIS
SGEIIGKGKPSIETPFHLGIYRSRPDVNAVIHCHPVSCTVLAIQKKDLRTNLTPESLMIL
GKDVPMIPYDTPGSDGLAEKLIATMGPSKACLMQNHGALVVGKDLMDAFFRMETLEYIAT
LQLKCGEVPGLPEDEIERVLAMSK
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaacaactttctcaggatctggctgatgtcggcaggctgctttatgaaaagcgt
ctgacaattgccagcggcggcaatatgagtgtaagggctggcaactctatgttgatcact
ccgtcaggtgtctgcaaaggaatgctttccggtcgcgatatgattgaaattgatatttca
tcaggagagataatcggaaaaggaaaaccatcaatcgagactcccttccatttagggatc
taccgttcccggcctgatgtaaatgcagtcatccactgccatcctgtttcttgcacagtt
cttgccatccagaaaaaagatctccgtacgaatcttactccagaatctttaatgatccta
ggaaaagatgtgccgatgataccttacgatactccaggttcagacggcttggctgagaaa
ttaattgccactatgggaccaagcaaagcctgcctgatgcagaaccacggcgctttggta
gtcggcaaagatctgatggatgccttcttcagaatggaaacccttgaatacattgccact
ttacaattgaaatgcggtgaggtacccggtcttccagaagatgaaatcgaaagggtactt
gctatgagcaaatga

DBGET integrated database retrieval system