KEGG   Methanomassiliicoccus sp. Mx1-Issoire: H729_08250Help
Entry
H729_08250        CDS       T02692                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mer  Methanomassiliicoccus sp. Mx1-Issoire
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mer00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    H729_08250
Enzymes [BR:mer01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     H729_08250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1748507..1750066)
Genome map
AA seq 519 aa AA seqDB search
MNLKARYIDMESAEYTCVLHDNDAIELGVREQDRIRIKHERNSIVALLQTTDTVVNQGEV
GILGRAYGVLGPERDEIVDVVPTSKPESVKYIKKKMRGEELTTEEIRTIINDIVQHNLSN
IELTAYVVALEINGMNIRETADLTMAMVETGDTITFDRGPIFDFHSVGGCPGNKITLIVV
PIVAAAGLIIPKTSSRAISSAAGTADIIEVFADVNMDAHKLRTVAEKVGGTLAWGGSMSL
SPADDTIIKVEYPLGIDPHAQLLASVMSKKKAAGANCLVIDIPTGAGTKVPTIEEAQAFA
RDFMDLGEKLGIEVRCAITYGEQPVGRAIGPALEAKEAITILEGSKHPSSVYEKSIGMAA
MVLEMGGIKNGEAKAKEILESGQALTKFREIVAAQGGNPNISSSDITVGMYKHDIISAMS
GYVNSIKNKQLVQIARAAGSPKDKGAGVVLNKKRGNRVLEGETLYTIYADHEAKLEQAIE
LARKLDPMVVENMIISKLPNSSKYTVIEETSSNVRSERN
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaaaagccagatatattgatatggaatccgctgaatacacctgcgtactccat
gacaatgatgctattgaacttggtgtaagagagcaggacaggatcaggattaagcatgaa
cgcaactcaatcgttgccctcctgcagacaacagatacagtagtaaatcagggagaagtc
gggatactaggaagagcctacggagtactgggacctgagcgtgatgagattgtagatgtc
gttccgacatccaagcctgaatctgtaaaatacataaagaaaaagatgagaggcgaagag
ctgactactgaagagatcagaacaatcatcaatgatattgtccagcacaatctcagcaat
attgaactgactgcgtacgtagtagctctggaaataaatggaatgaatatccgggaaact
gcagatcttaccatggcaatggttgaaacaggagacaccatcacatttgaccgcggtccg
atatttgatttccactcagtaggaggatgtcctggcaataagattaccctgattgtggtt
cccatcgtagcagccgcgggactcatcatacccaagacctcgtccagagcaataagttca
gctgcaggaaccgcagatatcatagaggtttttgcagacgtgaacatggatgcccataaa
ctgagaactgtagctgaaaaagtaggcggtacactggcatggggaggctctatgagtctt
tctcctgctgatgacacgataattaaagttgaataccctcttggaatcgatcctcatgcc
cagcttcttgcatccgtaatgtctaagaagaaggcagctggtgcaaactgtcttgtgatt
gatattccaaccggtgctggaactaaagttcctaccatcgaagaggcgcaggcatttgcc
agggactttatggatctgggagaaaaactcggaatcgaagtaagatgtgcaataacatat
ggggaacagcctgtaggtagagccatcggaccagcgctggaagctaaggaagccatcaca
attctggaaggttcaaagcaccccagcagcgtctatgagaaatccataggcatggccgca
atggtgctggaaatgggaggcataaaaaacggtgaagccaaggccaaagagatccttgaa
tcgggtcaggcactgactaagttcagagagattgtagctgctcagggcggcaatccaaac
atttcgtcatctgacatcaccgttgggatgtacaagcatgatatcatttctgcaatgtct
gggtatgtcaactctataaagaataaacaactggtgcagattgccagagcagccggttct
ccaaaggacaagggtgcaggagtagtactcaataaaaaacgcggaaacagggtgctggaa
ggagagacgttatacacaatctatgcagaccatgaagccaaacttgagcaggcaatagag
ctggctagaaagctggatcccatggttgtagaaaatatgatcatctccaaactgccgaac
tccagcaaatacacagttattgaggaaacttcgtcaaacgtccgcagtgaacgcaattaa

DBGET integrated database retrieval system