KEGG   Chelativorans sp. BNC1: Meso_0021Help
Entry
Meso_0021         CDS       T00374                                 

Definition
3-hydroxyacyl-CoA dehydrogenase
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
mes  Chelativorans sp. BNC1
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mes00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Meso_0021
   01212 Fatty acid metabolism
    Meso_0021
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Meso_0021
   00650 Butanoate metabolism
    Meso_0021
  Lipid metabolism
   00071 Fatty acid degradation
    Meso_0021
   01040 Biosynthesis of unsaturated fatty acids
    Meso_0021
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Meso_0021
   00310 Lysine degradation
    Meso_0021
   00380 Tryptophan metabolism
    Meso_0021
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Meso_0021
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Meso_0021
   00281 Geraniol degradation
    Meso_0021
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    Meso_0021
Enzymes [BR:mes01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Meso_0021
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Meso_0021
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Meso_0021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(20985..23207)
Genome map
AA seq 740 aa AA seqDB search
MAGYKNFTVEVDSEGIALVTWNMPDRSMNVFTEEVMGELDKIIDQVAGDAGIKGAVFTSG
KETFSGGADLSMLQNMLGRYHKEKAKSPEKATRELFDRAGSMSKLWRKLEVSGKPWVSAI
NGTCMGGAFELSLACHGRVAVDDDSVKLALPEVKVGIFPGAGGTQRVPRLTNTQEALQML
TSGQNLSPQKAKAMGLVHEIVPRKKLVDAAKRMIKDGLKPVQPWDEKGFKLPGGPVYSAA
GANLWPPAIAILRRETYGNYPGATAILKCVYEGLLVPFDTALRIEQRYFTEIMQSKEAAA
MIRSLFISMQELNKGARRPKDVPAKKIRKVGVLGAGFMGAGIAYVTAKAGIPVVLIDRDQ
ESADKGKAHSAGLMDGLIKKGRATAEEKEKLLSLITATPDYSALEGADLVIEAVFEDSAV
KKEATEKAEAALKSSAIFASNTSTIPITSLAKNSKRPKNFIGLHFFSPVDRMMLVEIILG
KKTGDKALALAMDYVRAIRKTPIVVNDTRGFYVNRCVLRYMQEAYSMLIEGVPAPMIENA
AKMAGMPVGPLALTDETAIDLAQKIMKQTIRDLGEKAVDPRHMELIDMMVDKHGRHGRKN
GKGFYEYPAKPAKKFLWPGLKDFYRQQDPDEIDVEELKARFLYVIALEAARVMEEGIVTD
PREADVGSILAFGFAPFTGGVLSLIDGIGAAEFVKRAERLQKKYGKQFKPPRLLLEMAEK
GETFYDRFAPEGVGGFKEAA
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atggctggctacaagaacttcaccgtcgaggtcgatagcgagggtatcgcactcgtcacc
tggaacatgccggaccgctcgatgaacgtcttcaccgaggaggtgatgggcgagttggac
aagatcatcgaccaggtcgcaggcgatgccggcatcaagggcgcggtcttcacctctggg
aaggagaccttctccggcggcgcggatctgtccatgctgcagaacatgctgggccggtat
cacaaagagaaggcgaaaagccccgaaaaggcgaccagagagctcttcgacagggccgga
agcatgagcaagctctggcgcaagctcgaagtttcgggaaagccctgggtttcggccatc
aacggcacctgcatgggaggagcgttcgagctttcgcttgcctgccatggccgtgtggcg
gtggatgatgacagcgtgaagctcgccctgcccgaggtgaaggtcggcatcttcccaggc
gcgggcggcacccagcgcgtgccgcggcttaccaacacgcaagaagctctgcagatgctc
acttccggccagaacctctcgccgcagaaggcgaaggccatgggactggtgcatgagatc
gtgcctcgcaagaagctggtcgatgcggcgaaaaggatgatcaaggacggactaaaaccc
gtccagccctgggacgagaaaggcttcaaactgcctggtggaccggtctattcggccgcc
ggcgccaatctctggccgccggccatcgccattctgcgccgcgagacctacggcaactat
cctggcgcaacagccatcttgaagtgcgtctatgagggcctgctggtccccttcgacacg
gctctccgtattgagcagcgttatttcacggaaattatgcagtcgaaggaggcggcggcc
atgatccgctcgctcttcatctcgatgcaggagctgaacaagggcgcgcgccggccaaag
gatgtgccggccaagaagatcaggaaggtgggcgtactcggcgcaggcttcatgggcgca
ggcatcgcctacgtgacagccaaggctggaatccctgtggttttgatcgaccgtgatcag
gaatcggccgataagggcaaagcccattcggccgggctgatggatggtctcatcaagaag
ggccgcgccacggcggaagagaaagagaagcttctttcgctcatcaccgcgacgccggac
tattccgcgctcgaaggcgccgatctcgtgatcgaggcggtgttcgaggattcggccgtg
aagaaggaagcgacggaaaaagcagaggctgcgctgaagtcctcggccatcttcgcctcc
aacacctccacaataccaatcacgagcctcgccaaaaattcgaagcggccgaaaaacttc
atcggcctccacttcttctctccggtcgacaggatgatgctggtggagattatcctgggc
aagaagacgggggacaaggcgctggcgctcgcgatggattacgttcgcgccatcaggaag
acgccgatcgtcgtcaacgacacgcgcggcttctacgtgaaccgctgcgtcctgcgctac
atgcaggaagcctattccatgctgatcgagggcgtgcccgcgcccatgatcgagaacgcc
gcgaaaatggccggcatgccggtcgggccgctagcgctcacggacgaaacggccatcgat
ttagctcagaagatcatgaagcagacgatccgcgatcttggcgagaaggcagtcgatccg
cgccatatggagctgatcgacatgatggtcgacaagcacggccgccacggccgtaagaac
ggcaagggcttttacgaatatcccgccaaaccggccaagaaattcctttggccggggctg
aaggatttttaccgtcagcaggaccccgacgagatcgatgtcgaggagctgaaggcgcgc
ttcctctatgtgattgcgctcgaggccgcgcgcgtgatggaggagggcatcgtcaccgat
cctcgcgaagcggatgtgggctcgatcctggccttcgggttcgcgccttttacaggcggc
gtcctctccttgatcgacggcattggcgcggcggaattcgtaaagcgcgccgagcggctg
cagaagaaatacggcaagcagttcaagccgcccaggcttttgctggaaatggctgagaaa
ggcgagaccttctatgaccgctttgcgccggaaggcgttggcggattcaaggaggccgcc
tga

DBGET integrated database retrieval system