KEGG   Chelativorans sp. BNC1: Meso_0311Help
Entry
Meso_0311         CDS       T00374                                 

Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
mes  Chelativorans sp. BNC1
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mes00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Meso_0311
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Meso_0311
Enzymes [BR:mes01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Meso_0311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
345245..346534
Genome map
AA seq 429 aa AA seqDB search
MTDFYTLVPSAPASRFDGIERTYSAEDVRRLRGSVTIRHTLAEQGANQLWKLLHEENFVN
ALGALSGNQAMQMVRAGLKAIYLSGWQVAADANTASAMYPDQSLYPANAGPELARRINRT
LQRADQIEVAEGKGLSVETWFAPIVADAEAGFGGPLNAFEIMKAYIEAGAAGVHFEDQLA
SEKKCGHLGGKVLIPTAAHIRNLTAARLAADIMGVPSLIVCRTDAEAAKLITSDIDERDQ
PFVDYEAGRTVEGFYQVKNGLEPCIARAVAYAPYSDLIWCETSKPDLEQARKFAEGVHKH
HPGKMLAYNCSPSFNWKKNLDDATIAKFQRELGAMGYKFQFITLAGFHQLNYGMFELARG
YRDRQMAAYAELQEAEFAAEARGYTATKHQREVGTGYFDAVSLAITGGQSSTTAMHGSTE
HDQFTQAAE
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgacagatttttacactcttgtcccctcagctcccgcgagccgcttcgatggcatcgag
cgaacctattcggctgaggacgtgcgtcggctgcgtggttccgtgacgatccggcatacg
cttgccgagcaaggtgccaaccagctttggaagctgttgcacgaagagaacttcgtgaac
gcgctgggtgcgctttccggcaaccaagcgatgcagatggtgcgcgcagggctgaaggcg
atttatctttccggctggcaggtggcggcggatgccaacaccgcctcggcgatgtacccc
gaccagtcgctctacccggccaatgccgggccggagcttgcacgccgcatcaaccgcacg
cttcagcgagccgatcagatcgaggtggcggaagggaaggggctctcggtcgagacctgg
ttcgcgcccatcgtggccgacgccgaggcgggctttggcgggccgctcaacgcgttcgag
atcatgaaggcatatatcgaggcgggtgcagccggcgtccatttcgaggatcagcttgcc
tcggaaaagaagtgcggccacctcggcggaaaggtgctgatccccaccgcggctcatatc
cgcaacttgaccgccgcgcggctcgcggcggatatcatgggcgtgccttcgcttatcgtc
tgccgcacggatgcggaggctgccaagctcatcacctccgatatagacgagcgcgaccag
ccctttgtggattatgaggcggggcgcaccgtcgagggcttctatcaggtgaagaacggg
ctagagccctgcatcgcgcgcgccgtggcttatgcaccctacagcgacctcatctggtgc
gagacctcgaagccggatcttgagcaggcgcgcaaattcgccgagggcgtgcacaagcac
catccgggcaagatgctggcctataactgctccccgtcgtttaactggaagaagaacctg
gacgacgcgaccatcgcgaaattccagcgcgagttgggcgccatgggctacaaattccag
ttcatcacactcgccggcttccaccagctcaattacggcatgttcgagctggcgcgcgga
taccgcgaccggcagatggccgcctatgccgaattgcaggaggccgagttcgccgccgag
gcgcgcggctacacggccacgaagcatcagcgcgaggtgggcacgggctatttcgatgcc
gtgtccctggcgatcacggggggccagtcctcgacgaccgccatgcacggctccaccgag
catgatcaattcactcaggccgccgaatag

DBGET integrated database retrieval system