KEGG   Chelativorans sp. BNC1: Meso_0451Help
Entry
Meso_0451         CDS       T00374                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
mes  Chelativorans sp. BNC1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mes00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Meso_0451
   00052 Galactose metabolism
    Meso_0451
Enzymes [BR:mes01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Meso_0451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
497665..498675
Genome map
AA seq 336 aa AA seqDB search
MAGGPRKIAVYEGREVFEATLTSSTGVKVSVISYGAVIRDWQVPVPGGMRSVVLGFEHFE
EYTKYSGYFGAIAGRVANRISGARFMLNGKEYRLQPNEGANHLHGGKRGLSRQVWDMEVL
SENAVRLSLTSPDGEMGYPGRLDVSVTYRLEGNALELDCTATTDAPTPVNIVQHNYFNLM
GEGDIRNHVLWLAANAYTVRDFDLIPTGGIEPVAGTHFDFRKPRPLCDAQGEPIAYDNNL
VLDTGRDPSSPVAILKAPDGSLTLALKTDQPGLQLYTGSKINLPVPGLGGRHYPRFAGLC
LEDQNFPDAINHPHFPNCVVTPERPYRHWCEIEIGQ
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgggccgaggaagattgccgtttacgaaggacgtgaagtcttcgaggcgacg
ctgacaagcagcacgggcgtgaaggtgtcggtcatcagctacggcgccgtcatccgcgac
tggcaagtgccggttcctggcggcatgcgcagcgtggtattgggtttcgaacatttcgaa
gaatataccaaatacagcggctatttcggagcaatcgccggtcgcgtcgcaaatcgcatc
tccggcgcgcgcttcatgctgaatggcaaggaataccggctccagccgaacgaaggcgcc
aaccatctgcacggcgggaaaagggggctgagccgtcaggtctgggacatggaggtgctt
tcggaaaatgcggttcgtcttagcctgaccagccctgacggagagatgggctatccggga
cggctggatgtctcggttacttaccggcttgaagggaatgcccttgagctcgactgcacg
gcaaccaccgatgcacccacgccggtcaatatcgtgcagcataactacttcaatctgatg
ggcgagggcgatatccgaaaccacgtgctttggctcgcggccaatgcctatacggtgcgg
gatttcgacctcatcccgacaggtggaatcgagccggtggccggcacgcatttcgatttc
cgcaaaccgcgccctctttgtgacgcccagggcgagccgatcgcctatgacaacaacctg
gttcttgataccggccgcgatccctcctcgcccgtggctattctcaaggcgccggacggc
tcccttacgctcgcgctcaagacggatcagccaggactgcagctctatacgggcagcaag
atcaaccttcctgtccccggcctgggcgggcggcactatccccgcttcgccgggctatgc
cttgaagaccagaacttccccgatgcaatcaatcacccgcatttccccaactgcgtcgtg
accccggagcggccatataggcactggtgcgagatagagatcgggcagtag

DBGET integrated database retrieval system