KEGG   Chelativorans sp. BNC1: Meso_0451Help
Entry
Meso_0451         CDS       T00374                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
mes  Chelativorans sp. BNC1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mes00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mes00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
497665..498675
Genome map
AA seq 336 aa AA seqDB search
MAGGPRKIAVYEGREVFEATLTSSTGVKVSVISYGAVIRDWQVPVPGGMRSVVLGFEHFE
EYTKYSGYFGAIAGRVANRISGARFMLNGKEYRLQPNEGANHLHGGKRGLSRQVWDMEVL
SENAVRLSLTSPDGEMGYPGRLDVSVTYRLEGNALELDCTATTDAPTPVNIVQHNYFNLM
GEGDIRNHVLWLAANAYTVRDFDLIPTGGIEPVAGTHFDFRKPRPLCDAQGEPIAYDNNL
VLDTGRDPSSPVAILKAPDGSLTLALKTDQPGLQLYTGSKINLPVPGLGGRHYPRFAGLC
LEDQNFPDAINHPHFPNCVVTPERPYRHWCEIEIGQ
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgggccgaggaagattgccgtttacgaaggacgtgaagtcttcgaggcgacg
ctgacaagcagcacgggcgtgaaggtgtcggtcatcagctacggcgccgtcatccgcgac
tggcaagtgccggttcctggcggcatgcgcagcgtggtattgggtttcgaacatttcgaa
gaatataccaaatacagcggctatttcggagcaatcgccggtcgcgtcgcaaatcgcatc
tccggcgcgcgcttcatgctgaatggcaaggaataccggctccagccgaacgaaggcgcc
aaccatctgcacggcgggaaaagggggctgagccgtcaggtctgggacatggaggtgctt
tcggaaaatgcggttcgtcttagcctgaccagccctgacggagagatgggctatccggga
cggctggatgtctcggttacttaccggcttgaagggaatgcccttgagctcgactgcacg
gcaaccaccgatgcacccacgccggtcaatatcgtgcagcataactacttcaatctgatg
ggcgagggcgatatccgaaaccacgtgctttggctcgcggccaatgcctatacggtgcgg
gatttcgacctcatcccgacaggtggaatcgagccggtggccggcacgcatttcgatttc
cgcaaaccgcgccctctttgtgacgcccagggcgagccgatcgcctatgacaacaacctg
gttcttgataccggccgcgatccctcctcgcccgtggctattctcaaggcgccggacggc
tcccttacgctcgcgctcaagacggatcagccaggactgcagctctatacgggcagcaag
atcaaccttcctgtccccggcctgggcgggcggcactatccccgcttcgccgggctatgc
cttgaagaccagaacttccccgatgcaatcaatcacccgcatttccccaactgcgtcgtg
accccggagcggccatataggcactggtgcgagatagagatcgggcagtag

DBGET integrated database retrieval system