KEGG   Chelativorans sp. BNC1: Meso_0490Help
Entry
Meso_0490         CDS       T00374                                 

Definition
ABC transporter
Orthology
K09691  
lipopolysaccharide transport system ATP-binding protein
Organism
mes  Chelativorans sp. BNC1
Pathway
ABC transporters
Module
Lipopolysaccharide transport system
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:mes02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(544754..545527)
Genome map
AA seq 257 aa AA seqDB search
MARINIRNASVSYFLRKSGAKVKSLERGAVGAQIVAGRRYLEITALKNITLSLNDGDRVG
LVGINGSGKSTLLKLCAGALAAQSGTVAIEGRVSPQFALGSGMKPALTGRQNTELKCLYM
GVPQSAIAAHVEEVKALSGLGGYFELPIQSYSAGMRSRLVMSLLRLVRGEILIMDEWINA
ADPSLSTKVSGLQAQLVERAKILLLASHSRRVLEEWVDTLAWLDQGEILALGRVGEVYPE
YQTWMKTRKIERQNSPT
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggccaggatcaacatcaggaacgccagcgtcagttactttctcagaaagtctggcgcc
aaggtaaaaagtctggagcgcggcgcagtcggtgcgcaaatcgtggctgggaggcgttat
cttgaaataacggcgctgaagaacatcacgctatcgctcaacgatggcgatcgcgtcggt
cttgtcggcatcaacggctcggggaaatcaaccctgctaaagctctgcgctggcgcgctc
gccgcgcaatccggaacggtggcaatcgaaggcagggtgagcccgcaattcgcactcgga
tcaggcatgaaaccggcgctgacggggcggcagaatacggagctgaaatgcctctatatg
ggtgtgccgcagagcgcaatcgccgcccatgtggaagaggtgaaagcgctttccgggctc
ggcgggtattttgagttgccaatacaaagctattcggccggaatgcggtcacgactcgtg
atgagtctgctgcgtctggtgcgcggcgaaattttgatcatggatgagtggataaatgca
gccgatccctcgcttagcaccaaggtaagcggtttgcaggcacagctagtggaaagggca
aagatcctcttgctcgccagccactcacgccgtgtccttgaggaatgggtggatactctt
gcatggctcgatcaaggcgaaattcttgcattaggcagagtaggtgaggtgtatcctgaa
taccagacgtggatgaaaacccggaagatagagcgacagaactcaccgacttga

DBGET integrated database retrieval system