KEGG   Chelativorans sp. BNC1: Meso_0490Help
Entry
Meso_0490         CDS       T00374                                 

Definition
(GenBank) ABC transporter related protein
  KO
K09691  
lipopolysaccharide transport system ATP-binding protein
Organism
mes  Chelativorans sp. BNC1
Pathway
ABC transporters
Module
Lipopolysaccharide transport system
Brite
KEGG Orthology (KO) [BR:mes00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Meso_0490
Transporters [BR:mes02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Lipopolysaccharide transporter [MD:M00250] [OT]
    Meso_0490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(544754..545527)
Genome map
AA seq 257 aa AA seqDB search
MARINIRNASVSYFLRKSGAKVKSLERGAVGAQIVAGRRYLEITALKNITLSLNDGDRVG
LVGINGSGKSTLLKLCAGALAAQSGTVAIEGRVSPQFALGSGMKPALTGRQNTELKCLYM
GVPQSAIAAHVEEVKALSGLGGYFELPIQSYSAGMRSRLVMSLLRLVRGEILIMDEWINA
ADPSLSTKVSGLQAQLVERAKILLLASHSRRVLEEWVDTLAWLDQGEILALGRVGEVYPE
YQTWMKTRKIERQNSPT
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggccaggatcaacatcaggaacgccagcgtcagttactttctcagaaagtctggcgcc
aaggtaaaaagtctggagcgcggcgcagtcggtgcgcaaatcgtggctgggaggcgttat
cttgaaataacggcgctgaagaacatcacgctatcgctcaacgatggcgatcgcgtcggt
cttgtcggcatcaacggctcggggaaatcaaccctgctaaagctctgcgctggcgcgctc
gccgcgcaatccggaacggtggcaatcgaaggcagggtgagcccgcaattcgcactcgga
tcaggcatgaaaccggcgctgacggggcggcagaatacggagctgaaatgcctctatatg
ggtgtgccgcagagcgcaatcgccgcccatgtggaagaggtgaaagcgctttccgggctc
ggcgggtattttgagttgccaatacaaagctattcggccggaatgcggtcacgactcgtg
atgagtctgctgcgtctggtgcgcggcgaaattttgatcatggatgagtggataaatgca
gccgatccctcgcttagcaccaaggtaagcggtttgcaggcacagctagtggaaagggca
aagatcctcttgctcgccagccactcacgccgtgtccttgaggaatgggtggatactctt
gcatggctcgatcaaggcgaaattcttgcattaggcagagtaggtgaggtgtatcctgaa
taccagacgtggatgaaaacccggaagatagagcgacagaactcaccgacttga

DBGET integrated database retrieval system