KEGG   Chelativorans sp. BNC1: Meso_0544Help
Entry
Meso_0544         CDS       T00374                                 

Definition
type III restriction enzyme, res subunit
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
mes  Chelativorans sp. BNC1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
601405..604443
Genome map
AA seq 1012 aa AA seqDB search
MKLKFKVQPYQTQAVTAVVDCFAGQPMSTGITYRIDPGRKTQTSAFEEGFKNADLALTEL
QVLANIKDVQLRQNLSLSDKLVTSAGCRINLDIEMETGTGKTYCYIKTIFEMNKRYGWSK
FIIMVPSIAIREGVHKSLQITADHFTESYGKKARFFIYNSKRLHELESFSSDAGINVMVI
NIQAFAARGADNRRIYEELDDFQSRKPIDVIASNRPILILDEPQKMEGAATMEALPKFKP
LMILRYSATHKTQHNRVHRLDALDAYNQKLVKKIAVRGIQTRGLAGTNAYLYLEGIEISK
KAPVARLEIEVKLASGEIKRQLKRLEFRDDLFAESGELDQYRDGFTISQIDARNDTVEFT
NGLVLQAGEATGDVSERDIRRIQIRETIKAHLDKEKQLFAQGIKVLSLFFIDEVVKYRDY
AQPDEKGEYARVFEEEYELLKAEYLAELAIDNDAYRKHLAGIDAAKTHNGYFSIDKKTNR
LKDPAVGARSVDSDDVDAYDLILKDKERLLSFAEPTRFIFSHSALREGWDNPNVFVMCML
KHSDNTVSRRQEVGRGLRLSVDQNGDRMDNPAVVHDINVLTVVASESYKNFVAGLQKEIA
DTLTSRPRKATEAYFTGKTITTDAGPIEITPAMAKQIYRYLVKNDYSDDADQITSAYHQA
KEAGTLAALPDELKAHADQIFQIIDSVFSDAQLPKVEDGRKPKTNPLNENFEKKEFQELW
RRINQKAVYRVEFDSDELVRKCVSALDSQLRVTPLQYTVQTGIQGDGLTDEQLKAGDGFA
LTGSTTERGGSVHSLVKYDLLGKIAENTELTRKTAAEILTGIQASVFGQFKENPEHFIAE
ASRIIAEQKATMVIERLAYDGLAERYDVDIFTANQTGQDFSKASAKLKRHVYDYVVTDSE
IERKFADELDTASEVVVYAKLPRGFLIPTPVGDYNPDWAISFKEGSVKHIYFVAETKGTM
SSMKLREIENTKIACARKFFDEISQRVSEERVKYDVVTSYEKLMDIVGRATA
NT seq 3039 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcttaaattcaaggtccagccctatcagacacaggccgtgactgcggtcgtggat
tgcttcgccgggcagccgatgtcgaccgggatcacctaccggatcgatcctggccggaag
acgcagacgagcgccttcgaggaggggttcaagaacgccgatctggcgctgaccgagctt
caggtgctggccaacatcaaagacgtccagcttcgtcagaacctgtctctttcggataag
ctggtcaccagcgccggatgccggatcaacctcgacatcgagatggagacggggaccggc
aagacctattgctacatcaagacgatcttcgagatgaacaagcgctacggctggtcgaag
ttcatcatcatggtgccgtcgatcgctatccgcgagggcgtccacaagtcgctgcagatc
accgccgaccatttcaccgagagctacggcaagaaggcgcggttcttcatctacaactcc
aaacgcctgcacgagctcgagagcttttcgtcggacgctggcatcaacgtgatggtgatc
aacatccaggcgttcgcggcccgcggcgctgacaaccgacgcatctatgaggagctggat
gacttccagtcgcgcaagcccatcgacgtcatcgccagcaaccggccgatcctgatcctc
gacgagccgcagaagatggaaggcgcggccacgatggaggcgcttccgaagttcaagccg
ctcatgatcctgcgctattcggcgacccataagacgcagcacaatcgcgttcaccggctg
gatgccctcgatgcctataaccagaagctggtgaagaagatcgccgtccggggcatccag
acgcgggggctcgccggcacgaacgcctacctctacctcgaggggatcgagatatcgaag
aaggcgccggtagcccggctcgaaatcgaggtgaagctcgcgagcggcgagatcaagcgc
cagctcaagcggctggagttccgtgacgacctgttcgccgagtccggcgagttggatcaa
taccgcgacggcttcacgatctctcagatcgacgcgcgcaacgacacggtcgaatttacc
aacggcctggtgctccaggctggggaggccaccggtgatgtgtccgagcgcgacatccgg
cgcatccaaatccgcgagacgatcaaggcgcatctcgacaaggagaagcagctcttcgcc
cagggcatcaaggtgctgtcgctgttcttcatcgacgaggtcgtgaagtaccgcgattac
gcacagccggatgagaagggcgaatatgcccgcgtgttcgaggaggagtacgagcttctc
aaggcggaatatctggctgagctggcgattgataacgacgcctatcggaagcacctggcg
ggcatcgatgcggccaagactcacaacggctatttctcgatcgacaagaagaccaaccgg
ctcaaggaccccgccgtcggcgcacggtcggtcgattcagatgacgtggacgcctacgac
ctgatcctgaaagacaaggaacggctgctgtctttcgcggaacccacgcggttcatcttc
tcgcattccgcactgcgcgaagggtgggacaatcccaacgtcttcgtcatgtgcatgctc
aagcacagcgacaacaccgtctcacggcgccaggaagtgggccgcggccttcgcctgtcg
gtcgaccagaacggcgaccggatggacaaccccgcggtcgtccatgacatcaacgtcctc
acggtcgtcgccagcgagagttacaagaacttcgtggccggcctccagaaggagatcgcc
gacacgctgacgtcgcgcccgcgcaaggcgacggaggcctatttcaccgggaagaccatc
acgacggatgctggcccgatcgagatcacgccggccatggcgaagcagatttaccgctac
ctcgtgaagaacgattattccgacgacgcagaccagatcaccagcgcctaccaccaggcg
aaggaggccggaaccctggcggccttgccggatgagctgaaggcgcatgccgatcagatt
ttccagatcatcgacagcgtgttcagcgatgcgcagctcccgaaggtcgaggacggccgc
aagccgaagaccaatccgctcaatgagaattttgagaaaaaggaattccaggagctctgg
cggcgcatcaaccaaaaggcagtttatcgggtcgagttcgactccgatgaattggtccga
aaatgcgtgagcgctctcgatagccagcttcgcgtgacgccgctccagtacacggttcag
accggcatacagggcgacgggttaacggacgagcagctgaaggcgggtgatggttttgcc
ctgacaggctcaacgaccgaacgcggcggatctgtccattcgctcgtgaagtacgacctc
ctcgggaagatcgccgaaaacacggagctcacgcgcaagactgcagcggaaatcctgacc
ggcatacaggccagcgtgttcgggcagttcaaggagaaccccgagcacttcatcgccgaa
gcgtcgcggatcatcgctgagcaaaaggccacaatggtaatcgagcggttggcctatgac
gggttggccgaacgctacgacgtcgacatcttcaccgcgaaccagaccggccaggacttc
tcgaaggcgtcggcgaagctgaagcggcacgtgtacgattacgtggtcaccgactccgag
atcgaacgaaagtttgccgacgagctggatacagcgagcgaggtggttgtctacgccaag
ctgccgcgcggtttcctgatcccgacgccggttggcgattacaaccccgattgggcgatc
tccttcaaggagggaagcgtcaagcacatctacttcgtcgccgagaccaagggcaccatg
tcctcgatgaagctccgcgagatcgagaacaccaagatcgcttgcgcccggaaattcttc
gacgagatcagtcagcgagtgtccgaggaacgggtcaagtatgacgtggtgacgagttac
gagaagctcatggatatcgtgggtcgcgcgacggcctga

DBGET integrated database retrieval system