KEGG   Chelativorans sp. BNC1: Meso_0664Help
Entry
Meso_0664         CDS       T00374                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mes  Chelativorans sp. BNC1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mes00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Meso_0664
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Meso_0664
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Meso_0664
Enzymes [BR:mes01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Meso_0664
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(743114..743959)
Genome map
AA seq 281 aa AA seqDB search
MTTTRIDRLFTKLKAENRPALVTYFMGGDPDYETSLSIMKALPVAGSDIIELGMPFSDPM
ADGPAIQAAGLRALKGGQTLDKTLRMAKSFRQDNDHTPIVMMGYYNPIYIYGVDRFLTEA
RASGIDGLIIVDLPPEMDEELCVPALRAGINFIRLATPTTDDKRLPKVLENTSGFVYYVS
MTGITGSALPDTSKVAGAVARIKGHTKLPVCVGFGVKTASQARAIGAAADGVVVGTAIVN
AVANVLGPDGKTTADPAEAVATLVRGLADGVREARITAAAE
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccacccgaattgacaggctcttcaccaagctgaaagccgagaacaggccagcg
ctcgtcacctatttcatgggtggcgaccccgattacgaaacgtcgctctccattatgaaa
gccctgccggtggccggcagcgacatcatcgagctcggcatgcccttttccgacccgatg
gccgacgggccggcgatccaggcggcggggctgcgcgcgttgaaaggcggacagacactg
gacaagacgcttcggatggcgaagagcttccggcaggataacgaccatacgccgatcgtc
atgatgggctactacaatcccatctacatctacggtgtagacaggttcctcacggaggcg
agagcgtccggcatcgacgggctcatcatcgtcgacctgccgccggagatggacgaagaa
ttgtgcgtgcccgcgttgagggccggcatcaacttcatccggctagcaacgccaacaacg
gacgacaagcgcctgcccaaggtgctcgaaaacacgtccggattcgtctattacgtgtcg
atgaccggcatcaccggctcggcgctgccggacacctccaaggtggctggcgccgtcgcc
cgcatcaaggggcataccaaactgccggtctgcgtcggctttggcgtaaagacggcgagc
caggcgcgtgcgatcggagcggccgcggacggcgtggtggtcggcacggctatcgtgaat
gcggttgcgaatgtgctcggccccgacggcaaaacaactgccgacccggcggaagcggtg
gcaaccctggtgcgcggccttgccgatggcgtgcgcgaggcgcgcatcacggccgccgcc
gaataa

DBGET integrated database retrieval system