KEGG   Chelativorans sp. BNC1: Meso_0831Help
Entry
Meso_0831         CDS       T00374                                 

Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
mes  Chelativorans sp. BNC1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mes00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Meso_0831
   00030 Pentose phosphate pathway
    Meso_0831
   00051 Fructose and mannose metabolism
    Meso_0831
   00052 Galactose metabolism
    Meso_0831
   00500 Starch and sucrose metabolism
    Meso_0831
   00520 Amino sugar and nucleotide sugar metabolism
    Meso_0831
  Nucleotide metabolism
   00230 Purine metabolism
    Meso_0831
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Meso_0831
Enzymes [BR:mes01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Meso_0831
    5.4.2.8  phosphomannomutase
     Meso_0831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(921065..922420)
Genome map
AA seq 451 aa AA seqDB search
MSAPFKAYDVRGRIPEEINSPFAYRFAQATKEALGPKSVVIGHDMRLDSPALAGALTQGL
LDSGVDVLPVGQCGTEEVYFHTARSGADAGLMVTASHNPPDYNGIKMVLKGAAAATPDNA
FNAIEELMRSDKVFPTASSYKERGTLHPLCDRNTYIERLLEEVAGQNLRPLKIVCHAGNG
CAGPIIDLLEKHLPFTFIKIDHDPDPWLPNGVPNPLLPEKREKASRAVVEQGADLAIAWD
GDFDRCFLYDHKGRFVEGYYLVGMIAQRMLKKAPGGTILYDPRLTWNTIDVVERAGGVAK
PCRTGHAYFKRMMREENAIYGGEMSAHHYFRDFAYCDSGMLTWLDVVCELSETGATLAET
LEERIAAFPCSGEINFTVADSKAVQERVAEHYQRFNPELETIDGLGMAFDNWRFNLRASN
TEPLLRLNVETRADQQLLEQKVQELRGLIEA
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctcccttcaaggcctatgatgtccgcggccgaatcccggaggagatcaacagc
cccttcgcctatcgcttcgcccaggcgacgaaggaggcacttgggccaaaatctgtcgtg
atcggtcatgacatgcggctcgacagtcctgctcttgccggcgcgctcacgcagggactg
ctcgacagcggcgttgacgtgctgcccgtcggccaatgcggcacggaggaagtttacttc
cataccgcccgttccggcgccgatgcgggacttatggtcaccgcgagccataacccgccc
gactataacggcatcaagatggtgctgaagggcgctgcggccgccacgcccgacaacgcc
ttcaacgccatcgaagagctgatgcgctcagacaaagtgttcccgactgcatcgagctac
aaggagcgaggaacgcttcatccgctctgcgaccgcaatacctatatcgagcgcctgctc
gaggaggttgcggggcaaaatttgagacccctgaagatcgtctgccacgcgggcaatggc
tgcgccgggccaatcatcgacctcctcgaaaagcatctgcccttcaccttcataaagatc
gatcacgatccagatccgtggcttcccaacggcgtgcccaatcctcttcttccggaaaag
cgcgagaaggcaagcagggcggtggtggagcaaggcgccgaccttgccatcgcctgggac
ggagatttcgaccgctgctttctctacgatcacaaggggcggttcgtggagggatactac
ctcgtcggcatgattgcccagcggatgctgaagaaggctccgggcggcacgatcctttac
gatccacgcctcacctggaacacgatcgacgtcgtggaaagagccggcggtgtggcgaag
ccctgccgcacgggccacgcctatttcaagcgcatgatgcgcgaggagaatgccatttac
ggcggcgagatgagcgcacaccattatttccgcgatttcgcctattgcgattcgggcatg
ctcacctggctcgacgtcgtttgtgagctgtcagaaaccggcgcaaccctggccgagacc
ttggaggaacgcatcgccgccttcccctgctccggcgagatcaatttcaccgttgccgat
tccaaggcggtgcaggagcgcgtggcagagcactaccagcgcttcaacccggaactggag
acgatagacgggctcgggatggccttcgacaattggcgtttcaatctgcgcgcctccaac
accgagccgctgctgcgtctcaatgtggaaacccgcgccgaccagcagctcctggagcag
aaagtgcaggaattgcgcgggttgatcgaagcctag

DBGET integrated database retrieval system