KEGG   Chelativorans sp. BNC1: Meso_1129Help
Entry
Meso_1129         CDS       T00374                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mes  Chelativorans sp. BNC1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mes00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Meso_1129
Enzymes [BR:mes01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Meso_1129
Exosome [BR:mes04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Meso_1129
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1236722..1237753)
Genome map
AA seq 343 aa AA seqDB search
MNKFSRLKMDPIRSVDEITGSRRLRRMRKASWSRRLVQENHLRVEDLIWPIFLVEGENRK
DPVEAMPGVYRYSVDLAVREAERAAKLGIPAIATFPNIGIKKRDVTGSAILDPDNLINQA
SRAIKAAVPEIGIITDVALDPFTSHGHDGILRDGVILNDETVAQVAEAAVLQAAAGADII
APSDMMDGRIGAIRDSLDANGFQDVAIMSYATKFASVFYGPYREAIGTGTLLTGDKKTYY
VDPANSDEAVREAEQDLLEGADMLMVKPGLPYLDIIRRLKDEFAMPTFAYQVSGEYSMIK
AAAANGWLDGEKAMLETLLAFKRAGCDGILTYFAPEAAQLLRA
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
ttgaataagttcagccgcctcaaaatggacccgatccgcagtgtcgacgagatcaccggc
agcaggcgtctgaggcgaatgcgcaaggcttcctggtcgcggcgtctggtgcaggagaac
cacctcagggtggaggatctcatctggccgatcttcctggtggaaggtgaaaaccggaag
gacccggtcgaagccatgcccggcgtctaccgttactcggtcgaccttgcagtgcgcgaa
gccgagcgggccgcgaagcttggaattccggccatagcgacctttcccaatatcggtatc
aaaaaacgggacgtgaccggatcggccattctcgatccggacaatctcatcaatcaggcc
agccgcgccatcaaggctgccgtgccggagatcggcatcatcacggatgttgcactcgac
cccttcaccagccatggccatgacggcatcctgcgcgacggtgtcatcctcaatgatgag
acggtggcgcaagtggcggaggccgccgtgcttcaagcggcagccggcgcggacataatc
gcaccatcggatatgatggatggcaggatcggcgcaattcgcgactcgctcgacgccaac
ggcttccaggacgtggcgatcatgtcctatgcgaccaaattcgcttccgtcttttatggg
ccgtaccgggaggcgatcggcactggaaccctgcttacgggcgacaagaaaacctattac
gtcgacccggccaattccgacgaagcggtgcgcgaagccgagcaggacctgctcgaaggc
gccgacatgctgatggtgaagccaggcctgccttatctcgacatcatcaggcggctgaag
gatgagttcgccatgcccaccttcgcctatcaggtttcgggcgaatattcgatgatcaag
gccgcggcagccaatggctggctcgacggcgagaaggccatgctcgaaaccctgctcgca
ttcaagcgtgccggttgcgatggcatccttacgtatttcgctccggaggcagctcaactt
ttacgcgcttag

DBGET integrated database retrieval system