KEGG   Chelativorans sp. BNC1: Meso_1162Help
Entry
Meso_1162         CDS       T00374                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mes  Chelativorans sp. BNC1
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mes00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Meso_1162
Enzymes [BR:mes01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Meso_1162
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1271645..1272592)
Genome map
AA seq 315 aa AA seqDB search
MPSKTIDHAFTARQITGAAGDPTYAGALSFMRRKFTKDVKGADAVVWGIPFDAAVSNRPG
ARFGPQAIRRASVIFDNDPQYPFHLDLFDTLAVVDYGDCLLDYGRHDLTPAAIETEASKI
LESGAFLVTLGGDHFVTWPLLRAHAARHGPLALVQFDAHQDTWWDDGNRIDHGSFVGRAV
RDGVIDPARSIQVGIRTHAPEDCGLKIVHGYDLEEIRAAEIARMIAERVGDAPAYITFDI
DCLDPAFAPGTGTPVAGGPSTAKMLSILRQLGGLNIVGADVVEVSPPYDHADVTAIAGAS
IAMHYLGLLAEKRRP
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgccatccaagaccatcgaccacgccttcaccgcgcggcagatcacgggagccgccggc
gacccgacttacgcgggcgccctctccttcatgcgccgcaaattcacaaaggatgtgaag
ggcgcggatgccgtggtgtggggcataccgttcgatgccgcggtttcgaaccggccgggc
gcgcgcttcgggccgcaggcgatccgccgcgcctccgtcatcttcgacaacgacccgcaa
tacccgtttcacctcgatctgttcgatacgctcgccgtggtcgactatggcgattgcctg
ctcgactatggccgtcacgaccttactcccgcggccatagagaccgaggcttcgaagatc
ctggaatcgggcgccttcctcgtcacactcggcggcgaccatttcgtcacctggccgctg
ctcagggcgcatgcggcccgacacggacccctcgccctcgtccagttcgatgcgcatcag
gacacctggtgggacgacggcaaccgtatcgaccacggctccttcgtcgggcgggcggta
cgggacggcgtgatcgatcccgcccgctccatccaggtcggcatccgcacccatgcgccg
gaggattgcggcctcaagatcgtgcatggctacgaccttgaggaaattcgtgccgccgaa
atcgcgcgcatgatcgccgagcgggtgggcgacgcgccggcctatatcaccttcgatatc
gattgcctggaccccgcctttgcgccgggcacgggcacgccggttgcgggcgggccttcg
acagcgaagatgctctccatccttcgccagctcggcgggctcaacatcgtgggtgctgac
gtggtggaggtttcgcccccttatgaccatgccgatgtcacggccattgccggggcctcc
atcgccatgcactatctggggcttctggcggagaagcgacggccataa

DBGET integrated database retrieval system