KEGG   Chelativorans sp. BNC1: Meso_1317Help
Entry
Meso_1317         CDS       T00374                                 

Definition
zinc-binding alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
mes  Chelativorans sp. BNC1
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mes00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Meso_1317
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Meso_1317
  Lipid metabolism
   00071 Fatty acid degradation
    Meso_1317
  Amino acid metabolism
   00350 Tyrosine metabolism
    Meso_1317
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Meso_1317
   00626 Naphthalene degradation
    Meso_1317
Enzymes [BR:mes01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Meso_1317
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1407476..1408504)
Genome map
AA seq 342 aa AA seqDB search
MRALQLVADRKLEIADVSPPPPPGHGEVTLRISAVALNHIDVWGWRGMAFAKRKLPLTVG
AEASGRVDAVGPGVSNLVPGQLVSIYGARTCGLCRPCREGRDNLCEHVGGVHGFHLDGFA
QEKINLPARLLVPAPPGVDEIGAAVAPVSFGTVEHMLFDNAKLEPGETILVHAGGSGIGS
AAIQLAKRMGCTVLTTVGSNEKIERAKALGADHVINYREDRFEGAVRKITKKRGVDVVFE
HVGADTWAGSMLCLKRGGRLVTCGSTSGVSTNMNLMQLFQQQLKILGSFGCRMENMADAM
QKMAAGIVAPVIDTEVGFEAIDTALKRMEGRDVFGKIILRVG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcattgcaactcgtcgcggaccgcaagctcgaaatcgcggacgtatccccaccc
cctccccccggccatggtgaggtgacgcttcggatctccgcggtcgcgctcaaccacatc
gatgtatggggctggcgcggcatggcctttgccaaacgcaagctgccgcttaccgtgggc
gcggaggcttccggccgggtcgacgctgtcggacccggcgtcagcaatctcgtgccgggt
cagcttgtatcaatctatggcgcgcgcacctgcgggctctgccgcccctgccgcgaaggc
cgcgacaatctttgcgagcatgtcggcggtgtgcacggctttcacctggacggcttcgcg
caggaaaagatcaacctgccggcgcgcctccttgtgcccgcgccgcccggcgtagacgag
atcggcgcggccgtggctcctgtctcattcggaacggtcgagcatatgctgttcgacaat
gcgaagcttgagcccggtgagacaatcctggttcatgccggcggctcgggcatcggctcc
gccgcgatccagcttgccaaacgcatgggctgcacggtcctcaccacggtgggttcgaac
gaaaagatcgaacgagcgaaggcgctgggcgccgaccatgtgatcaattaccgcgaggac
cgcttcgaaggcgccgtgcgcaagatcaccaaaaaacgcggcgtggatgtagtgttcgag
catgtgggcgccgatacctgggcaggctccatgctgtgcctcaagcgcggcgggcggctc
gtcacctgcggctcgacctcgggcgtttccacgaatatgaacctgatgcagctcttccag
cagcagctcaagatcctcggctccttcggctgccgcatggagaacatggccgacgccatg
cagaaaatggcagccgggatcgtcgctccggtcatcgataccgaggtcggctttgaggcc
atcgacacggctttgaagcgcatggaaggccgggatgttttcggcaagatcatcctgcgt
gtgggctag

DBGET integrated database retrieval system