KEGG   Chelativorans sp. BNC1: Meso_1359Help
Entry
Meso_1359         CDS       T00374                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mes  Chelativorans sp. BNC1
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mes00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mes00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1452192..1453151)
Genome map
AA seq 319 aa AA seqDB search
MTDAPGFPLFPHPHLLGIKGLSPADIELLLERADAAVAISRRPEKKLATLRGRTQINLFF
EASTRTQSSFELAGKRLGADVMNMSVASSSTKKGETLLDTAMTLNAMRPDILVVRHSAAG
AAALLAQKVGCSVVNAGDGAHEHPTQALLDALTIRRKKGSIAGLVVAICGDVLHSRVARS
NILLLNALGARVRVIAPSTLLPSGIGQMGVEPFTKMGEGLAGADVVMMLRLQRERMAGTF
VPSVREYFRFFGLDAEKLKAAKEDALVMHPGPMNRGVEIASEVADGPQSVIQEQVEMGVA
VRMAVMEALLDPRRNGDGA
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgcgccgggctttcccctcttccctcacccccacctcctgggcatcaagggc
ctttcgcccgccgatatcgagctcctgctcgagcgggccgacgctgccgttgcgatctcg
cggcggccggaaaagaagctcgccaccttgcgcgggcgcacccagatcaatctcttcttt
gaggcatccacccggacccagtcttccttcgagctggcggggaagcggcttggagccgat
gtcatgaacatgtcggtcgcaagctcctcgaccaaaaagggcgagacgcttctcgatacg
gcgatgacgctcaacgccatgcggcctgatatccttgtggttcgccattccgcggcgggc
gcggcggcgctgcttgcgcagaaggtaggctgctcggtggtgaatgctggcgacggcgcg
catgaacaccccacgcaggcccttctcgacgcgctcaccatacgccgcaagaaaggcagc
atcgctgggctcgtcgtcgcgatctgcggtgacgttctccactcgcgcgtcgcgcgatca
aacatccttcttctcaacgcgctcggcgcgcgtgtgcgcgtcattgccccttccaccctt
ctgccctccggcatcggccagatgggggtcgagcccttcacgaaaatgggcgaagggctt
gccggggccgatgttgtgatgatgctgaggctccagcgcgagcgcatggccggcaccttc
gtgccttccgtgcgggaatatttccgcttcttcggcctcgatgccgaaaagctcaaagcc
gccaaggaggatgcgctggtcatgcatcccggaccgatgaaccgcggagtcgagatcgct
tcggaagtggctgacggtccgcaaagcgtgatccaggaacaggtggagatgggcgttgcc
gtacgcatggcggtgatggaagccctgctcgatccgcgccgcaacggggacggagcatga

DBGET integrated database retrieval system